KEGG   Bacillus megaterium NBRC 15308 = ATCC 14581: BG04_1997Help
Entry
BG04_1997         CDS       T03825                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
bmeg  Bacillus megaterium NBRC 15308 = ATCC 14581
Pathway
bmeg00071  Fatty acid degradation
bmeg00362  Benzoate degradation
bmeg00650  Butanoate metabolism
bmeg01100  Metabolic pathways
bmeg01120  Microbial metabolism in diverse environments
bmeg01200  Carbon metabolism
bmeg01212  Fatty acid metabolism
Module
bmeg_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bmeg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BG04_1997
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BG04_1997
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BG04_1997
Enzymes [BR:bmeg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BG04_1997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 ApbA NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AJI23183
UniProt: A0A0B6AR85
LinkDB All DBs
Position
complement(1831961..1834339)
Genome map
AA seq 792 aa AA seqDB search
MNIKKAAVLGSGVMGSGIAAHLANVGIPTLLLDVVPTSLTADEEKKQLTLEDRQVRNRLS
TTALAKLTKQKPAPLTSKSSLSLITPGNLEDHLQQLSECDWIIEVVVERLDIKQQLFERI
DSVRKKGSIVSSNTSGISIHEMAKGRSEDFKAHFLGTHFFNPPRYLKLLEIIPTHDTKSE
IVEYMKTFGEDVLGKGVVIAKDTPNFIANRIGTYGLLVTVQEMLKGNYSVGEVDSVTGPL
IGRPKSATFRTLDVVGLDTFIHVANNVFDKVEGKEKEVFDVPLFMKQMQENGWLGSKSGQ
GFFLKKGKEILELDPSTLQYVERKKLKTASTELSKQAKGLQNKMKALIYSGDRAGQLLWN
IISPVLVYAAQLKDEIADDIVAIDQAMKWGFGWKLGPFETWDAIGLEKSMEKMEQEGLAI
PQWVKQMQENGFTSFYKEMEGQTLYYEDEEYKAVKENKKVIHLSSLRSQNNVILENSGAS
LIDLGDDVACLQFTSPNNAIGLDIISLLNQSLEEVNKNYKGLVIGNQGKNFCVGANLAMI
LMEAQDDNYFEIEFVIKQFQQAMMKVKYNEKPVVAAPFAMALGGGAEICLPSAKIQASAE
TYMGLVEVGVGLIPGGGGNKELYIKQLSGLPNGVTLDLQQIANKTFETIATAKVSTSAAE
AKQLNFLNRHDGISVNGDHLLNDAKNSVLALHDTGYKPPVRTKIPVVGETGYATLLLGAQ
SMKYSGYISEHDYKIASKLAFVLAGGRVAFGSEVDEEYLLDLEREAFLSLVGEAKSQERM
QHMLVKGKPLRN
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgaacataaaaaaagccgccgttttaggttcaggagttatgggctctggaattgcagct
catttagcaaatgtaggaattccaacgcttttgctagacgtggttccaacttcattaaca
gcagacgaggaaaaaaaacagctaacgcttgaagataggcaagtgagaaatcggttgagt
acaactgctctagctaaattaacgaagcaaaaaccggcacctttaacgtcgaagtcatca
ctatcgttaattacgccaggaaatcttgaagatcatttacagcagttaagcgagtgtgat
tggattattgaagtagtagtggaacgtcttgatattaaacagcagctgtttgaaagaatt
gacagtgtacgaaaaaaaggcagtatcgtaagttcaaatacttcaggaatatcgatccac
gaaatggctaaaggacgctcagaagattttaaagcgcattttttaggaacgcactttttt
aatccaccacgttatttaaagttattagaaatcattccaactcatgacacaaaatcagaa
attgttgaatatatgaaaacgtttggtgaagatgtattaggtaaaggagtagttattgca
aaagatacgcctaactttatcgccaaccgtatcggtacgtacggtttacttgtgactgtt
caagaaatgttaaaaggcaattacagcgtgggagaagttgactctgtgacgggtccctta
attggaagaccaaaaagtgcaacgtttcgaacgttagacgtagtgggactagacacattt
attcatgtggccaacaatgtgtttgacaaagtggaaggcaaagaaaaagaagtattcgat
gtgcctttatttatgaaacaaatgcaggaaaatggctggttaggaagcaagtcagggcaa
ggcttctttttaaagaaaggaaaggaaattctagaacttgatcctagtacacttcaatac
gtcgagagaaagaagttaaaaacagcttctacggaattaagcaagcaggcaaaagggctg
caaaacaaaatgaaagcgcttatatactccggtgatcgtgccggccagcttctttggaac
atcatcagtcccgttcttgtgtatgcagctcagttaaaagatgaaattgccgacgatatc
gtggccattgatcaggctatgaagtgggggtttggctggaaactgggtccgtttgagacg
tgggatgcaattggtttagaaaaatcaatggagaagatggagcaggagggcttagcaatt
ccgcagtgggtaaaacaaatgcaggaaaacggatttacaagcttttataaagaaatggaa
ggtcaaacgctttattacgaagatgaggagtataaagcggtaaaagaaaataaaaaggtg
attcacctgtcgtctttacgctctcaaaataatgtcattttagaaaacagcggagcgagt
ttaattgatttaggagatgatgtggcgtgcctgcagttcacttctcctaacaatgcaatt
gggctagatattatcagcttattaaatcagtctcttgaagaagtgaataagaactataaa
gggctggtcataggaaatcaaggaaaaaatttctgcgttggcgctaacttagctatgatt
ttaatggaagcacaagatgacaattattttgaaattgaattcgttattaaacaatttcaa
caggcaatgatgaaggtgaaatacaatgagaagccggttgttgcagctccgtttgcaatg
gctcttggaggcggagcagaaatttgcttgccgtcagctaaaattcaagcttctgctgaa
acttacatgggccttgtagaagtaggagtcggactcattcctggtggaggaggtaacaag
gagctttatatcaaacagttaagtggtttacctaacggtgtaacgctcgatcttcagcag
attgcgaataaaacatttgaaacaattgctactgcaaaagtatccacttctgctgcagaa
gctaaacagctaaatttcttaaatcgccatgatggcatcagcgtaaacggagatcacctg
ctgaatgacgcgaagaactcagtccttgctttacatgacacgggctataaaccgcctgta
agaactaagatccctgtcgttggagaaacagggtatgcaacgttgctgctaggagctcaa
tccatgaagtattcaggatatatatcagaacatgattataaaattgctagtaagttagca
tttgtgttagccggaggacgtgtagcgtttggttcggaagttgatgaagagtatttgctg
gacttagagagagaagcatttttaagccttgttggagaagcgaagtctcaagaacgtatg
cagcacatgttagttaaaggaaaaccactgcgcaattaa

DBGET integrated database retrieval system