KEGG   Bacillus megaterium NBRC 15308 = ATCC 14581: BG04_2499Help
Entry
BG04_2499         CDS       T03825                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bmeg  Bacillus megaterium NBRC 15308 = ATCC 14581
Pathway
bmeg00473  D-Alanine metabolism
bmeg01100  Metabolic pathways
bmeg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bmeg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BG04_2499 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BG04_2499 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bmeg01011]
    BG04_2499 (alr)
Enzymes [BR:bmeg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BG04_2499 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bmeg01011]
 Precursor biosynthesis
  Racemase
   BG04_2499 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C MCR_alpha_N
Motif
Other DBs
NCBI-ProteinID: AJI22421
UniProt: A0A0B6AG03
LinkDB All DBs
Position
2319872..2321032
Genome map
AA seq 386 aa AA seqDB search
MDAFYRETWAEIDVEAIFQNVNHVRELIPGHKTLMAVVKANAYGHGDKEVAEIALQAGAD
MLAVAFLDEAIALRKKGIKESILVLGAVPTLHIQTALEWDVTVTAYSKAWIEEAASILGE
NSQLHMHLKIDTGMGRLGVRTKEELHETMKIIASHSGFVLDGVFTHFATADELNSSYFEE
QYTFFEEMVRIVKEYNFTPPMIHCANSAALLRRPKDIFNGVRLGIAMYGLSPSEELKEVL
PIPLKQAFSLHSRIVHVKKVKKGSHISYGATYEAKEDEWIATIPVGYADGWIRKLSNFEV
LVDGVKVPIVGRICMDQLMIKLPKMYKMGTKVTFIGKQKGAEITIDEVAKHLETINYEIP
CMVAARVPRVYTRDSQHIDVNNYILR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggatgcattttatagagaaacatgggcagaaattgatgtagaagccatttttcaaaat
gtgaatcatgtaagagaactaataccggggcataaaacgttaatggccgtagtgaaggcg
aatgcgtacgggcatggagataaagaagtagcagagattgcgcttcaagctggtgctgat
atgctagctgtagcttttttggatgaagctattgctcttcggaaaaaaggaataaaggaa
tccattttagtattaggcgccgtgcctaccctacacattcaaactgcattggagtgggat
gtaacggtcactgcttatagcaaagcttggattgaagaagcggcgtccattctaggtgaa
aacagtcagctgcatatgcatttaaaaatagatacaggcatgggtcgcttgggagttaga
acaaaagaagaattacacgaaacgatgaagatcatcgcttctcattcgggattcgtgctg
gatggagtgtttacacactttgcaacagcagacgagctaaactcgtcttattttgaagaa
caatacacattctttgaagaaatggttcgaattgtgaaagaatataattttacacctccg
atgattcactgtgcaaatagcgcagccttgcttcgtcgtccgaaagatatctttaatggc
gtacgcttaggtatcgctatgtatggtttgagtccttctgaggaattaaaagaagtcttg
ccaattccgttaaaacaagctttttcgctgcacagccgtattgtgcatgttaaaaaagtc
aaaaaagggagtcatatcagttacggagctacttatgaagctaaagaagatgaatggatt
gctactattccagtaggatacgcagacggctggattcgtaaattaagcaattttgaagta
ttagtagatggagttaaagtgccaattgttggtagaatctgcatggatcaattgatgatt
aaattacctaaaatgtataaaatgggtacaaaagtaacatttattggaaaacaaaaaggt
gctgaaattacaattgatgaagtagcgaagcatcttgaaacaattaattatgaaatccct
tgcatggttgcagcaagggttccgagggtttatacaagagattcgcagcatattgatgtt
aataattatatcttgcgctga

DBGET integrated database retrieval system