KEGG   Bacillus megaterium NBRC 15308 = ATCC 14581: BG04_2582Help
Entry
BG04_2582         CDS       T03825                                 

Gene name
gatC
Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
bmeg  Bacillus megaterium NBRC 15308 = ATCC 14581
Pathway
bmeg00970  Aminoacyl-tRNA biosynthesis
bmeg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmeg00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BG04_2582 (gatC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bmeg03029]
    BG04_2582 (gatC)
Enzymes [BR:bmeg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BG04_2582 (gatC)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BG04_2582 (gatC)
Mitochondrial biogenesis [BR:bmeg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BG04_2582 (gatC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: AJI22811
UniProt: A0A0B6AH07
LinkDB All DBs
Position
2402031..2402321
Genome map
AA seq 96 aa AA seqDB search
MSRISVDQVKHVANLARLAVTDDEAELFTKQLDAIITYAEQLDELDTTNVKPTSHVLNMK
NVMREDKPAKGLPIEDVVKNAPDHKDGYIRVPTILE
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagaatttctgttgatcaagtaaaacacgttgcaaacttagcgagacttgcggtg
acggatgacgaagctgaactatttacaaaacaattagatgctattattacatatgcagaa
caattagatgagttagatactacaaatgtaaaaccaacttctcacgtattgaatatgaaa
aacgtaatgcgtgaagataagccagctaaaggtttaccaattgaagacgtagtgaaaaat
gcaccagaccacaaggatggctacattcgagtaccaactattttagaataa

DBGET integrated database retrieval system