KEGG   Bacillus megaterium NBRC 15308 = ATCC 14581: BG04_2646Help
Entry
BG04_2646         CDS       T03825                                 

Gene name
spoII
Definition
(GenBank) beta-amylase
Organism
bmeg  Bacillus megaterium NBRC 15308 = ATCC 14581
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_14 CBM_20 Glyco_hydro_42
Motif
Other DBs
NCBI-ProteinID: AJI22868
UniProt: A0A0B6AQG2
LinkDB All DBs
Position
2474710..2476347
Genome map
AA seq 545 aa AA seqDB search
MKQLCKKGLAFVLMFIFVNAFILSPINGAAAVDGKSMNPGYKTYLMAPLKKVTDYTTWEA
FENDLRKAKQNGFYAVTVDFWWGDMEKNGDQQFDFSYAQRFAQAARNAGIKIVPIISTHQ
CGGNVGDDCNVPLPSWVWNLKSDDSLYFESETGTTNKETLSPLATDVISKQYGELYTAFA
QALAPYKDVIAKIYLSGGPAGEIRYPSYTAADGTGYPSRGKFQVYTNFAKSKFQSYALTK
YGSLAGINQAWGTNLTSASQILPPSDGYQFLKDGYSTAYGKDFLAWYQGALEDHTKRIGQ
LAHQAFDSTFNVPIGAKVAGIHWQYNNPTIPHAAEKPAGYNDYNALLDAFKIAKLDITFT
CLEMTDSGNYPEYSMPKTLVRQVAGIANAKGVVLNGENALTIGSEDQYKKAAEMAFNYNF
AGFTLLRFYDVINNDTLMGQFKNTLGVTPLAQTVVVKNAPTALGETVYIVGDRAELGQWD
TSIYPIKLTYNSSTADWRGTVHFPASQNVQFKAIVKRADGSLKAWQPSQQYWSVPSTTTT
YTDNW
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagctatgtaaaaaagggttggctttcgttttgatgtttatttttgttaacgct
ttcattttgagtccaattaacggagcggctgccgtagatggaaaatcaatgaatccaggt
tacaaaacctatttaatggcgcctttaaaaaaggtaacagactatacaacatgggaagcg
tttgagaacgatttacgcaaagcgaaacaaaatggattttatgcagtgacagtagacttc
tggtggggagatatggagaaaaacggcgatcagcagttcgatttttcctatgcgcagcgc
tttgctcaagcagctcgtaatgcaggtataaagatcgttcctattatttctactcatcag
tgtggaggcaatgtaggagatgattgtaacgttccgcttccatcttgggtatggaactta
aaaagtgatgacagcctttactttgaatctgaaacaggtacgacaaataaagaaacgcta
agcccgcttgcaacggacgttatttctaagcaatacggagagctctacactgcatttgcg
caagcgttagcaccttataaagacgtgattgctaaaatctatttatcaggaggccctgca
ggtgaaattcgttatccgtcttatacagcagcagacggaaccggctatccgtctagaggg
aaatttcaagtgtatacgaacttcgccaaaagcaagtttcaatcatatgctttgactaaa
tacggttcactcgccggcattaatcaagcatggggaaccaatttaacgtctgcatcgcaa
attttaccaccatcagatggctatcagttcttaaaagatggttattcaacagcttatgga
aaagatttcttagcatggtatcaaggagctttggaagatcatacaaaacgtattggacag
ttagctcatcaggcttttgattccacctttaacgtaccaatcggtgcaaaagtggcagga
attcattggcagtataacaatcccacgattcctcatgctgcagaaaaacctgctggatat
aatgattacaacgcgcttttagatgcgtttaaaatagctaaattagatataacgtttacg
tgcttagaaatgacggacagcggaaattatccggaatattctatgccaaagacgcttgta
cgccaggtagcaggtattgcgaatgcaaaaggagttgttttaaacggggaaaatgcttta
actataggcagtgaagatcaatataaaaaagcagctgaaatggcctttaactataatttt
gcaggatttactttgcttcgtttctacgatgttattaacaatgatacgctgatggggcaa
tttaaaaatacgttgggcgttacaccacttgcgcaaacggttgtagtaaaaaatgcgcca
actgcattaggagaaacggtttatattgttggagacagagctgagctaggtcagtgggat
acgtccatttatccaattaaattaacatataattcatctacagctgattggagaggcacc
gtccattttcctgcgagtcaaaatgttcaatttaaagcaattgtgaagagagctgatgga
tcgttaaaagcatggcagccttcgcagcaatattggagcgtgccgtcaacaacaacgact
tatacagataattggtaa

DBGET integrated database retrieval system