KEGG   Bacillus megaterium NBRC 15308 = ATCC 14581: BG04_3078Help
Entry
BG04_3078         CDS       T03825                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bmeg  Bacillus megaterium NBRC 15308 = ATCC 14581
Pathway
bmeg01100  Metabolic pathways
bmeg01120  Microbial metabolism in diverse environments
bmeg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bmeg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BG04_3078 (aepX)
Enzymes [BR:bmeg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BG04_3078 (aepX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AJI24460
UniProt: A0A0B6AHX5
LinkDB All DBs
Position
2894421..2895938
Genome map
AA seq 505 aa AA seqDB search
MKKTKQLRELIESKQLEFIMEAHSALSAKIVEEAGFKGIWASGLSLSAALGVRDNNEASW
TQVLDILEFMSDATSIPILLDGDTGYGNFNNARRLVKKLEQRDIPGVCIEDKLFPKTNSF
IKGEAQPLADINEFCGKIKAMKDSQNDEDFVVVSRVEAFIAGWGLKEALKRAEAYRQAGT
DAVLIHSKRSDMTEIEAFMKEWGNRLPVIIVPTKYYSVPTDKFSDLGISLSIWANHNLRS
SITAMQKTSAQIYYDKSLINVEKNVSPLEEVFRLQKAEELDIAEKLYLSSANHSMNAMIL
VKESANEALITEQINQLKKVGVTNSIKVGSDKAMEDKAFPNKGELYHLYAARDKLGTATL
ISDSNIVYKTHVFEELIHESGDITIVAGADYELKGNQTSYVTAKLPYSKQLYSKTVDLIQ
MSRNPNSNNIHGEFIGLWKVSAKGTEVVKKALEELAQRKDFAQLTFSDFFNYVNLIHPVA
VKYTMGSWIDTETYTKIQKDGGKND
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagactaaacagctaagagagttgatagaaagtaaacagctagagtttattatg
gaggctcacagtgcgctatctgcaaagattgtagaagaagcagggttcaaagggatatgg
gccagcggcctatcattatctgcagcactgggtgtaagagataataatgaggcttcatgg
acacaggtattagacatcttagagtttatgagtgacgcaacgtccattccaattcttcta
gatggtgatacaggctatgggaactttaataatgcaagaagattagttaagaaattggag
cagcgagacattccaggcgtatgtattgaagataaattgtttccaaaaacaaactcattt
attaaaggtgaagcacagccgcttgcagatattaatgaattttgcggcaaaatcaaagca
atgaaagatagccaaaatgacgaagattttgtagtggtatcgcgtgtagaagcttttatt
gcagggtgggggctgaaggaagctttaaaacgtgcagaagcttatcgccaagcgggaacc
gacgccgttttgattcatagtaaaaggtcagatatgacagagattgaagcttttatgaaa
gagtggggaaacaggcttccggttattattgttccaaccaaatattattcagttccaact
gataaatttagtgatttaggaattagcttgagcatttgggccaaccataacttaagatct
tccattacagctatgcaaaaaacgtccgctcagatttattacgataaaagcttgattaac
gtagaaaaaaatgtctctccgcttgaggaagttttccgtcttcaaaaagctgaagagcta
gacatcgcagagaaactttatttaagctctgccaaccatagcatgaacgctatgattctg
gtaaaagaatcagcaaatgaagctttgataactgagcagataaatcagttaaaaaaagtc
ggcgtgacaaatagtataaaagtaggttccgacaaagctatggaagataaggcgtttcct
aataaaggggaattatatcatctctatgctgcaagagataagttaggaacggctacttta
ataagcgatagtaacatcgtatataaaacacatgtttttgaggagttaattcatgaaagt
ggcgatatcactattgtagcaggagctgattatgagttaaaagggaatcaaacatcttat
gtaactgctaaacttccctattccaagcagctgtattccaaaacagtagacttgattcaa
atgtcgcgcaatccaaactctaacaacattcacggtgaattcattggtctttggaaagtt
tccgcaaaaggcactgaggttgtaaaaaaagctttggaagaactggcgcaaagaaaagat
tttgctcagctcacgttttctgatttctttaattatgttaatctaattcacccggttgct
gttaaatatacaatggggtcatggatagataccgaaacgtatacaaagattcaaaaagat
ggtgggaaaaatgattag

DBGET integrated database retrieval system