KEGG   Bacillus megaterium NBRC 15308 = ATCC 14581: BG04_3106Help
Entry
BG04_3106         CDS       T03825                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bmeg  Bacillus megaterium NBRC 15308 = ATCC 14581
Pathway
bmeg00620  Pyruvate metabolism
bmeg00680  Methane metabolism
bmeg01100  Metabolic pathways
bmeg01120  Microbial metabolism in diverse environments
bmeg01200  Carbon metabolism
Module
bmeg_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bmeg00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BG04_3106
  Energy metabolism
   00680 Methane metabolism
    BG04_3106
Enzymes [BR:bmeg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BG04_3106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 SSXRD FXR_C1
Motif
Other DBs
NCBI-ProteinID: AJI21547
UniProt: A0A0B6AKH4
LinkDB All DBs
Position
2925001..2927769
Genome map
AA seq 922 aa AA seqDB search
MVTVEAAERQNSSTALRRDVKFLGQLLGKVLVHQGGEELLSKVEKIREVAKSLRENKDEV
IYKEIKNEIVTLEQPMREQVIRAFAVYFHLVNIAEQNHRIRRRREYQQQEDSIMQPGSLE
SAVVSLKNNGVAPDVIANLLQTLSLELIITAHPTEATRRSVLDIHKRMAELLKNLDNPTL
TKRERTEIEERLFSEVLILWQTNELRDRKPTVMDEVSNGLYYFDETLFEVLPQLHQELEN
SLQENYPEENWKVPNILRFGSWIGGDRDGNPNVTPKVTWQTLVKQRKLAIRKYKESLTQL
RQRLSQSTKRVAVSDNLLDSINQEISLLPEKKRWRIKHEVYRCKLTIMLHKLNLVGESEA
GYQRSEELLHDLFLIKDSLQKHQPQDYQLKSLCKLIRQVELFGFHLATLDIRNHSGEHEA
AIKEIFHAVSLAEDYSALTEEKKVELLGKVLQDPRPVISFVENYSKETQQVIEVFNMIHR
AHKEFGERSIEVYLISMTQSASDLLEVMVLAKEAGIYRLHADGRIESKLNIAPLLETIDD
LTAGPKIMEQLFQLDFYREHLRKQQDLQEIMLGYSDGSKDGGTLTANWKLYKAQQEIHDM
AKKYQVRLKFFHGRGGSLGRGGGPLNRSILSQPVETLGDGVKITEQGEVLSSRYALYDIA
YRSLEQAVSALLTAAANVSQEAEQCDIRTHEWEETMDEISTASLRKYQELVFKDPDFLTY
FKQATPLPELGALNIGSRPMSRKGSDRFEDLRAIPWVFAWTQSRQLLPAWYAAGTGLQHL
VEKSGDIQLLQQMYKEWPFFRSTVDNLQMALTKADLMAAKEYTEMVQDPAISERIFTAIK
KEYNLTKEMILQITGQKELMDHLPTIKESIKLRNPYVDPLTFLQVKVISKLREDEAGTLN
EELLKEALLTINGIAAGLRNTG
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atggtaacagtagaagcagcagaaagacaaaacagcagcactgccctgcgccgtgatgtt
aagtttctcggtcaattgttagggaaagttctggttcaccaaggtggagaagaactgctc
agcaaagtagaaaaaatacgcgaagtagcaaaatcacttagagaaaacaaagatgaagtt
atctataaagaaataaaaaatgaaatcgttactcttgaacagccgatgcgcgagcaggtt
attcgggcgtttgcagtttattttcatttagttaatattgcagagcaaaatcatcgaatt
cgtcgcagacgcgaatatcagcagcaagaagattctattatgcagccgggctcattggaa
agtgccgttgtttcgcttaaaaataatggcgtggcgccagacgtaattgctaacttgctt
caaactctatccctagagctcatcatcactgctcatccaacagaagccactagacgaagt
gtccttgatattcataaacgaatggctgagcttctaaaaaacttggataatccaacgtta
acaaaacgtgaacgtacggaaattgaagaaagactgtttagcgaagtattgattttatgg
caaacaaatgaactgcgagatcgcaagccgacggtaatggatgaagtatccaatggatta
tattattttgatgaaacgttatttgaagtgcttcctcaacttcatcaggagttggaaaat
tcattgcaggagaattaccccgaagaaaattggaaggtgcctaatattcttcgatttggt
tcatggattggcggagaccgagatggaaatccaaacgtaactcctaaagtaacgtggcaa
acgcttgtcaaacaaaggaagttagctattcgtaaatataaagagtcacttactcaattg
agacaaaggttaagtcagtctacaaaaagagtcgcagtttcagataatcttcttgattct
attaatcaagaaatatcgctgctgcctgagaaaaagcgatggagaatcaaacacgaagta
tatcgctgcaagcttacgattatgcttcataaattaaatttagttggagaatcggaagca
ggttatcaaaggtcggaagaacttctacatgatttatttctaatcaaagatagcctgcaa
aagcaccagcctcaggattatcagttaaaaagcttatgtaaattaattcgccaagttgag
ctgtttggttttcatttagcaacgcttgatatccgtaatcacagcggggaacatgaagcg
gcaatcaaagaaattttccatgctgtttctttagctgaagattattcagcgttaacggaa
gagaaaaaagtcgagctgctagggaaagttcttcaagacccaagacctgtgatatcgttt
gtagagaattactctaaagaaacgcagcaagtaattgaagtatttaacatgatacatcga
gcacataaagaatttggagaaagatctattgaagtctacttaatcagtatgacgcagtct
gcaagtgacttgttagaagtcatggtactcgccaaagaagcgggtatttaccgccttcat
gcagatggccgcattgaaagtaagttaaatatagctccgctgcttgaaacgattgatgat
ctcacagcgggtcctaaaatcatggaacagctatttcaattagatttttatcgtgagcac
ttaaggaaacagcaggatttgcaggaaattatgcttggctactcagatggaagcaaagat
ggaggaacgcttactgctaattggaagctctacaaagcgcagcaggaaattcatgatatg
gcgaagaagtatcaagttcgtctgaagtttttccatggtcgaggcggctcactaggtcga
ggcggtggtccgttaaaccgaagcattttatctcagcctgttgagacgctaggagacggt
gtgaaaattacagagcaaggagaagttctttcttctagatacgctttatatgacattgct
taccgaagccttgaacaagcggtctcagctcttcttacagcggcagcaaatgtttctcaa
gaagctgaacaatgtgatattcgtacacatgaatgggaagaaacaatggacgagatttca
actgcttctttacgtaagtatcaagagcttgttttcaaagatccagactttttaacgtat
tttaaacaagctacacctcttcctgagctgggggctttaaatattgggtcacgtccaatg
agtcgaaaaggaagtgatcgctttgaagacttgcgagccattccgtgggtatttgcatgg
actcaaagcagacagctgcttccagcctggtacgctgcaggtacgggcttacagcattta
gtagagaaatccggagatatacagcttcttcagcaaatgtataaagaatggccattcttc
cgctcgaccgtcgataatctgcaaatggccttaacaaaagcagatttaatggcagcaaaa
gaatacacggaaatggtacaagacccggctatttcagagcggatttttaccgccattaaa
aaagaatataatctcacaaaagaaatgattcttcaaatcacaggtcaaaaagaattaatg
gatcatcttcctacgattaaagaatctattaaattacgaaatccgtatgtggaccctcta
acattcttacaagttaaggtcatttccaagctgcgtgaagatgaggctggaacgttaaat
gaagaacttttaaaagaagcgttattaacgattaacggcattgcagcagggttgcgtaac
acaggctga

DBGET integrated database retrieval system