KEGG   Bacillus megaterium NBRC 15308 = ATCC 14581: BG04_3548Help
Entry
BG04_3548         CDS       T03825                                 

Definition
(GenBank) aminotransferase class I and II family protein
  KO
K08969  aminotransferase [EC:2.6.1.-]
Organism
bmeg  Bacillus megaterium NBRC 15308 = ATCC 14581
Pathway
bmeg00270  Cysteine and methionine metabolism
bmeg01100  Metabolic pathways
Module
bmeg_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bmeg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BG04_3548
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bmeg01007]
    BG04_3548
Enzymes [BR:bmeg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     BG04_3548
Amino acid related enzymes [BR:bmeg01007]
 Aminotransferase (transaminase)
  Class I
   BG04_3548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Alliinase_C Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AJI25015
UniProt: A0A0B6AJG6
LinkDB All DBs
Position
3404527..3405699
Genome map
AA seq 390 aa AA seqDB search
MKQFEQSELLKSLPKQFFASLVGKVGKVMAQGHDVINLGQGNPDQPTPSHIVETLQKASA
NPMHHKYSPFRGHQFLKEAVATFYKREYGVDVDPEKEVAILFGGKGGLVEIPQCLLNPGD
TVLVPDPGYPDYWSGVELAKAKMEVMPLTAENHFLPVYEEISERAKEQAKLMFLNYPNNP
TGAVATAEFFEDTVAFAAKHDICVVHDFAYGAIGFDGKKPISFLQTPGAKETGIEIYTLS
KTYNMAGWRVGFAVGNESVVEAINLLQDHMYVSLFGAVQEAAAAALLESQQCVNDLVKRY
ESRRNTFIQGLREIGWDVTSPAGSFFAWLKVPEGYTSEQFSDLLLEKAHVVVAPGVGFGT
YGEGYVRVGLLTDEERMREAVSRIKKLNLF
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaatttgagcaatcggaactattaaaaagtttaccaaaacaattttttgcatca
cttgtgggcaaggtaggaaaagtaatggcccaagggcacgacgttattaacttagggcag
ggaaatcctgatcagcctactccttcacatattgtagaaacactgcaaaaagcaagtgct
aatcctatgcatcataaatattctccatttcgggggcaccagtttttaaaagaggccgtt
gcgactttttataaacgagaatatggcgttgatgtggatcctgaaaaagaagtagctatt
ttatttggcggaaagggtggacttgttgaaatcccgcagtgcttgttaaatcctggagat
acggtgctggttccagatcctggatatcctgactactggtctggagtagagcttgcaaaa
gccaagatggaagtgatgcctctcacggctgaaaatcattttctacccgtatacgaagag
ataagtgaacgtgctaaagaacaggcaaagctcatgtttttaaactatccgaataatcct
actggtgcagtggcaacggcagaattttttgaagacaccgtggcgtttgctgccaagcac
gatatttgtgtggtacacgactttgcttacggagcaattgggtttgatggtaaaaagcca
atcagttttttacagactcctggtgcaaaagagacgggaattgaaatttatactctttct
aaaacgtataacatggcgggatggcgagttggatttgctgtaggaaatgaaagtgtagta
gaagctattaatcttcttcaagatcatatgtatgtcagtctctttggggccgttcaagag
gcagcagccgcagctctgttggaatctcaacaatgtgtgaatgatttagttaagcgctat
gaatctagacgcaatacctttattcaagggcttcgagaaattggttgggatgttacatct
ccagcaggctccttttttgcatggctaaaagttcctgaaggatatacttccgaacagttt
tcagatttactccttgaaaaagcccacgttgtggttgctcctggtgtaggctttggaaca
tatggtgaaggctatgtgcgcgtaggattgctgacggatgaagagcgcatgagagaagct
gtatctcgaataaaaaaattaaatttattttaa

DBGET integrated database retrieval system