KEGG   Bacillus megaterium NBRC 15308 = ATCC 14581: BG04_3878
Entry
BG04_3878         CDS       T03825                                 

Definition
(GenBank) PTS system, mannose/fructose/sorbose family, IIA component domain protein
  KO
K11194  fructose PTS system EIIA component [EC:2.7.1.202]
Organism
bmeg  Bacillus megaterium NBRC 15308 = ATCC 14581
Pathway
bmeg00051  Fructose and mannose metabolism
bmeg02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bmeg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BG04_3878
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BG04_3878
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmeg02000]
    BG04_3878
Enzymes [BR:bmeg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     BG04_3878
Transporters [BR:bmeg02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BG04_3878
SSDB
Motif
Pfam: EIIA-man DUF4460
Other DBs
NCBI-ProteinID: AJI23041
UniProt: A0A0B6AHP6
LinkDB
Position
3736185..3736625
AA seq 146 aa
MISVIISGHGDFAPALEGSSKMIFGEENHVVAVPFLKGEGIQTLEEKYKQALEEMPLENE
VLFLVDIFGGTPYNAATPYILKNKTADMVSGVNLPMLLEVLAMREHVTLKEMLGRLKQVN
EESFQVCSEHLEKIQQANQIGEDGLL
NT seq 441 nt   +upstreamnt  +downstreamnt
atgatttcagtcattattagtggacatggtgatttcgcgccagcgttagaggggtcttcc
aaaatgatatttggtgaagagaatcacgtagtagccgtaccttttctaaaaggagagggt
atccaaacccttgaagaaaaatataagcaggcattagaggaaatgcccttagaaaatgaa
gtgctttttctagtcgatattttcggaggtacaccctacaatgcggctactccatatatc
cttaaaaataaaacagcggatatggtatccggagttaacttgcctatgttattagaagtg
ttagccatgagggaacatgttacattaaaagagatgctaggaagattaaagcaggtaaat
gaagaaagttttcaagtgtgcagtgaacatttggagaaaatccagcaagcgaaccaaatc
ggagaggatggattattatga

DBGET integrated database retrieval system