KEGG   Bacillus megaterium NBRC 15308 = ATCC 14581: BG04_3879
Entry
BG04_3879         CDS       T03825                                 

Gene name
levE
Definition
(GenBank) fructose-specific phosphotransferase enzyme IIB component
  KO
K11195  fructose PTS system EIIB component [EC:2.7.1.202]
Organism
bmeg  Bacillus megaterium NBRC 15308 = ATCC 14581
Pathway
bmeg00051  Fructose and mannose metabolism
bmeg02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bmeg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BG04_3879 (levE)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BG04_3879 (levE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmeg02000]
    BG04_3879 (levE)
Enzymes [BR:bmeg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     BG04_3879 (levE)
Transporters [BR:bmeg02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BG04_3879 (levE)
SSDB
Motif
Pfam: PTSIIB_sorb
Other DBs
NCBI-ProteinID: AJI24917
UniProt: A0A0B6AV06
LinkDB
Position
3736622..3737116
AA seq 164 aa
MKIVLARIDDRFIHGQVLTRWIKTNAADRIIIVSDEVAADEMRKTLILSVAPSNVKASAV
SISKMTKAFHSPRYQDTTAMLLFENPADIVALVQAGVPIETVNVGGMRFANDRKQITKSV
SVTEKDIDAFEKLQELGVKLELRQLPSDSSENFIQLLRNETKIK
NT seq 495 nt   +upstreamnt  +downstreamnt
atgaaaatcgttttagcaagaattgatgaccgctttattcacgggcaggtattaacaaga
tggatcaaaacaaatgcagcagatcgaattatcattgtttcagatgaggtggcagcggat
gaaatgcgaaaaacgcttattctttctgtggctccttcgaatgtaaaagcgagcgctgtc
tcgatttctaaaatgacaaaagcatttcacagccctcgttatcaggatacaacagccatg
ctgctgtttgaaaaccccgcagacattgtcgctcttgttcaagcgggcgtacctattgag
acagtaaacgtagggggcatgcgttttgctaatgaccgaaaacaaatcactaaatctgta
agcgttaccgaaaaagatatcgatgcttttgagaaactgcaggaactaggcgtaaagctt
gagctgcgccaattaccttcagattctagtgaaaattttattcaactactgagaaacgaa
acaaaaatcaaataa

DBGET integrated database retrieval system