KEGG   Bacillus megaterium NBRC 15308 = ATCC 14581: BG04_3881
Entry
BG04_3881         CDS       T03825                                 

Definition
(GenBank) PTS system, mannose/fructose/sorbose, IID component family protein
  KO
K02771  fructose PTS system EIID component
Organism
bmeg  Bacillus megaterium NBRC 15308 = ATCC 14581
Pathway
bmeg00051  Fructose and mannose metabolism
bmeg02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bmeg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BG04_3881
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BG04_3881
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmeg02000]
    BG04_3881
Transporters [BR:bmeg02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BG04_3881
SSDB
Motif
Pfam: EIID-AGA
Other DBs
NCBI-ProteinID: AJI22665
UniProt: A0A0B6ACJ4
LinkDB
Position
3737962..3738789
AA seq 275 aa
MENEKRLTKKDIFSMFIRSNFLLGSFNFERVQAMGYCYVMIPAIKRLYGPGAQRNAALKR
HLEWFNTHPWISAPIFGVTAAMEEEMANKKDFDEKAISGMKIGLMGPLAGVGDPIFWGTL
RPVLAALGASLALGGNIAGPLLFFILINAIRLSTKYYGLKYGYLKGTEILKDLVGNRIQK
LTEGASILGLFVMGALVSKWTTINIPVVVSRIKDDSGKVVVKTVQDVLDSILPGLLPLAL
TLLVAWMLRKGTNPLLIIFGIFLIGIGGYWIGFLG
NT seq 828 nt   +upstreamnt  +downstreamnt
atggaaaatgaaaaaagattaacgaaaaaagatatctttagcatgttcattcgttcgaat
tttttacttggttcatttaactttgaacgtgttcaagcaatgggctactgttatgttatg
attccagcaatcaaacgcttatatggaccaggagctcagcgaaatgcagcattaaagcgt
cacttagaatggttcaatacacacccatggatttccgcacctatattcggcgtcacggca
gcaatggaagaagaaatggcaaacaaaaaagattttgatgaaaaagctatcagcggaatg
aaaattggattaatgggcccgcttgctggtgtaggagaccctattttctggggaacgctt
cgaccagttctcgcagccctaggcgcctcgcttgcgttaggcggtaatattgccgggcca
ctgctgtttttcatcttaattaatgcaattcgattaagtacaaaatattatggattaaaa
tatggttacttaaaaggaacagaaattttaaaagatttagtaggcaatcgaattcaaaaa
ctgacggaaggtgcatccattttaggactcttcgtaatgggagcgttggtttcgaaatgg
accactattaatataccagtggttgtttctaggatcaaagatgattctggtaaagttgtg
gtaaaaaccgtgcaagacgtacttgatagtattctaccggggctgcttcctttagcacta
actctattagtagcatggatgcttcgaaaaggtacaaatccgctgcttattattttcggt
attttcttaattggtatagggggttattggataggctttttaggatga

DBGET integrated database retrieval system