KEGG   Bacillus megaterium NBRC 15308 = ATCC 14581: BG04_4217Help
Entry
BG04_4217         CDS       T03825                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bmeg  Bacillus megaterium NBRC 15308 = ATCC 14581
Pathway
bmeg00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bmeg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BG04_4217
Enzymes [BR:bmeg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BG04_4217
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BG04_4217
    1.1.1.-  
     BG04_4217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AJI22630
UniProt: A0A0B6ACG3
LinkDB All DBs
Position
4063569..4064618
Genome map
AA seq 349 aa AA seqDB search
MKALRWHGVKDVRLEHIAEPTVSQGKVKIKVEWCGICGSDLHEYTAGPIFIPTEELHPLS
KDKAPVVLGHEFSGQVVEIGEGITNVKVGDRVVVEPIYACGECENCKQGKYNLCNKMGFY
GLAGGGGGFSEYASIPVEMIHKIPEAVSYEQGALVEPSAVALHAVRQSKLKVGDKAAVFG
TGPIGLLVIEALKASGASEIYAIELSEQRRQKAEELGAIAINPQEYDPVAEVHKRTGGGV
DVSYEVTSVPLVLTQAINSTKSGGETMIVSIFEKEASIHPQTIVLQERTVTGIIGYRDVF
PAVISLMAKGYFSADKLVTKRIKLENVIEEGFETLLKEKEQVKILVKAE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattaagatggcatggcgttaaagatgtaaggttagaacatattgcagaacct
actgtctctcaaggaaaagtgaaaattaaagtagaatggtgtggaatttgcggaagtgat
ttgcatgagtacacggcaggacccatttttattcctacagaagaactccatccattaagc
aaagataaagcgccggtggtactggggcatgaattttctggacaagttgtagaaattgga
gaaggtattacgaatgtaaaagtcggagacagagtagtggtagaacctatctatgcatgc
ggagagtgtgaaaactgtaaacaaggaaagtataatctttgtaataaaatggggttttat
ggtcttgccggaggtggcggaggtttttctgagtatgcctccataccggtagaaatgatt
cataaaataccggaagcggtgtcttacgagcaaggagctctcgtagagccttcagctgtg
gctcttcatgctgtgcgtcaaagcaaactaaaggtaggagataaagccgccgtatttggg
acggggccaatcggtttgctagttattgaagcgttaaaagcctcgggtgcatctgaaatt
tatgcgatcgaactatcggaacagcgcagacagaaagctgaagaacttggggcgattgcc
attaacccgcaagaatacgaccccgtagcagaagtacataagcgcacaggcggaggtgta
gacgtttcctatgaagtgacaagtgttcccttagttttaactcaagctattaattctacc
aaaagtggcggggagacaatgattgttagcatatttgaaaaagaagcgtccattcatccc
caaacaatcgttttacaagagcgtacagtaacaggtattattggctaccgcgatgtattt
ccagcggttattagtttaatggcaaaaggctatttttctgctgataaactggtgacaaaa
cgtatcaagctagagaatgtaattgaagaaggttttgagacattgttaaaagaaaaagaa
caggtgaaaattttggtgaaagctgaataa

DBGET integrated database retrieval system