KEGG   Bacillus megaterium NBRC 15308 = ATCC 14581: BG04_4844Help
Entry
BG04_4844         CDS       T03825                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bmeg  Bacillus megaterium NBRC 15308 = ATCC 14581
Pathway
bmeg00250  Alanine, aspartate and glutamate metabolism
bmeg00410  beta-Alanine metabolism
bmeg00430  Taurine and hypotaurine metabolism
bmeg00650  Butanoate metabolism
bmeg01100  Metabolic pathways
bmeg01110  Biosynthesis of secondary metabolites
bmeg01120  Microbial metabolism in diverse environments
bmeg02024  Quorum sensing
Module
bmeg_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bmeg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BG04_4844
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BG04_4844
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BG04_4844
   00430 Taurine and hypotaurine metabolism
    BG04_4844
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BG04_4844
Enzymes [BR:bmeg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BG04_4844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC dCache_3
Motif
Other DBs
NCBI-ProteinID: AJI25468
UniProt: A0A0B6AXR3
LinkDB All DBs
Position
complement(4662887..4664290)
Genome map
AA seq 467 aa AA seqDB search
MPQWHPHREQKNLPDEFPVNPLFSRQGEVTIPRLRISDQGMLPETAYQIIHDEIALDGNA
RLNLATFVTTWMEPDAKRLYGESFDKNMIDKDEYPQTAAIEERCVRILADLWNSPNPDTT
MGVSTTGSSEACMLGGLALKRRWQKLRKSKGLSTDRPNIVFSSSVQVVWEKFANYWDVEP
RYVNINPDHPYLDAEGVINAVDENTIGVVPILGVTYTGVYEPIAAIAKVLDELQEKTGLD
IPIHVDAASGGFIAPFLQPDLIWDFRLPRVKSINVSGHKYGLVYPGLGWVIWREKEDLPE
DLIFRVSYLGGNMPTFALNFSRPGAQVLLQYYNFLRLGKDGYYAVQKTSQENALFLSKEI
GEMEAFEILADGSDIPVLAWKLKEGYTPNWTLYDLSRQLRTYGWQVPAYPLPADMEEITI
MRIVVRNGFSRDLAHLFMVNFKQAVEFLNSLDRPVLKDTKYDNGFHH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaatggcatccgcatcgtgaacaaaaaaatttacctgatgaatttcctgttaat
ccacttttttctcgacaaggagaagtgacgattccaaggctgcgtatcagtgatcaaggt
atgcttccagaaacagcttatcaaatcattcatgatgaaattgctttagacggaaatgcc
cgtttaaatttagctacgtttgttactacgtggatggagcctgatgcaaagcgtttgtac
ggagaatcttttgataaaaatatgatcgataaagacgagtatccgcagacagcggctatt
gaagagagatgtgtacgtattttagcggatttgtggaattcacctaatcctgatacaacg
atgggcgtttctactacaggttcatctgaagcatgtatgcttggcggactggctttaaaa
agacgctggcagaaactgcgtaaaagtaaagggctatcaacggaccgcccgaacattgta
tttagttcatccgttcaagtggtgtgggagaagttcgcaaactattgggacgtagaacct
cgttatgtgaacattaatccagatcatccttatttagatgcagaaggcgtcattaatgcg
gttgacgaaaatacaattggcgtcgtaccgattcttggagtgacgtatacaggagtttac
gaaccaattgctgctatcgcaaaagtattagatgagttacaggaaaaaacagggttggat
attcctattcatgtagatgccgcttctggaggttttatcgctccatttcttcaaccagac
ctcatctgggatttccgcttgcctcgagtaaagtccattaacgtgtcaggacacaagtat
ggtttagtttatcctggcttgggatgggtgatttggagagaaaaagaggacttgcctgaa
gatcttattttccgcgtttcttatttaggaggcaacatgccaactttcgcgctcaacttc
tctagaccaggagcacaagttcttttacagtactacaatttcttgcgtttaggtaaagac
ggctattatgctgtgcaaaaaacctctcaagaaaacgcgctgtttctcagcaaagaaatt
ggagaaatggaagcattcgaaattcttgctgatggttcagatatcccggttcttgcttgg
aaactgaaagaaggatatacgccaaactggacgctttatgatttgtctagacaactgcgt
acgtatggatggcaagttcctgcttatccgctgcctgcagacatggaagaaataacaatc
atgcgcattgtcgttagaaatggattttcaagggaccttgctcatttatttatggttaat
ttcaaacaagccgttgaatttcttaactcgttggatagacctgttcttaaagacacgaaa
tacgacaatggatttcatcattaa

DBGET integrated database retrieval system