KEGG   Brucella melitensis bv. 1 16M: DK63_2343Help
Entry
DK63_2343         CDS       T03831                                 

Definition
(GenBank) glutaminase family protein
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
bmel  Brucella melitensis bv. 1 16M
Pathway
bmel00220  Arginine biosynthesis
bmel00250  Alanine, aspartate and glutamate metabolism
bmel00471  D-Glutamine and D-glutamate metabolism
bmel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmel00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DK63_2343
   00220 Arginine biosynthesis
    DK63_2343
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    DK63_2343
Enzymes [BR:bmel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     DK63_2343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AIJ87586
UniProt: Q8YBJ3
LinkDB All DBs
Position
2:268705..269100
Genome map
AA seq 131 aa AA seqDB search
MEAVDIYTRQCSTLVTATDLATMGATLAAGGVNPISGKRMVSAGNVAPILAEMTMEGLYT
ALGDWAYTVGLPGKSGVGGGIMAVVPGELAIAAFSPPLDPAGNSVKAMAAVAAVADSLGH
NLYTTRGKVSS
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgtggatatttatacgcgccaatgttcaacgcttgtaaccgcgaccgacctt
gccacgatgggggcaacccttgccgccggcggtgttaatccgatcagcgggaagcgcatg
gtttcggcaggcaatgttgccccaattctggccgaaatgaccatggaaggcctttatacg
gctttaggcgattgggcttatacggtcggcctacccggtaaaagcggtgtcggtggtggc
atcatggcggtagtgccgggtgagctggcaattgccgcgttttcaccgccgcttgatcca
gccggaaatagtgtgaaagcaatggctgctgttgccgcagtggcagattcacttggccat
aatctttataccaccagagggaaagtgtcatcctga

DBGET integrated database retrieval system