KEGG   Brucella melitensis bv. 1 16M: DK63_440Help
Entry
DK63_440          CDS       T03831                                 

Definition
(GenBank) HAD hydrolase, IA, variant 1 family protein
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
bmel  Brucella melitensis bv. 1 16M
Pathway
bmel00630  Glyoxylate and dicarboxylate metabolism
bmel01100  Metabolic pathways
bmel01110  Biosynthesis of secondary metabolites
bmel01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bmel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DK63_440
Enzymes [BR:bmel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     DK63_440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like Hydrolase_3 DUF4279
Motif
Other DBs
NCBI-ProteinID: AIJ88764
UniProt: Q8YH23
LinkDB All DBs
Position
1:435235..435885
Genome map
AA seq 216 aa AA seqDB search
MKLVLFDCDGTLVDSGDFIHRCMAASFADAGFAPPAVADTYSTIGLSLPLAIARLLGREP
DDQVHWLTQRYKENFVTMRQAADFNEPLYEGILPLLAELGGRDDLLLGLVTGKSRRGVRS
VFERHGIGHYFTVARTADDCPSKPHPAMVLESCAEMGIEPSRTIVIGDAIYDMQMARSAG
VSWGYHHRQGLMEADAHHILEKPSDLHALLLEMEEF
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaaactggttctcttcgattgcgatggcacattggtggatagtggcgattttattcat
cgctgcatggcggcaagttttgccgatgccggttttgctccgcccgcagtcgcggatacc
tattcgaccatcggcctgtccctgccgctggccatcgcccgattgctggggcgtgagcct
gacgatcaggtgcactggctgacacagcgctacaaggaaaattttgtcaccatgcggcag
gcggcagatttcaacgagccgctctatgagggtatcctgccgcttctggccgagcttggc
gggcgcgatgaccttctgctcggccttgtgacgggcaaatcccggcgcggcgtgcgttcg
gtttttgagcgccatggtatcgggcattatttcaccgtggcccgaaccgccgatgattgt
ccgtcgaagccgcatcccgccatggtgcttgaatcctgcgcggaaatgggaatagaaccc
agccggacaatcgttatcggcgatgccatatacgatatgcagatggcccgatccgcaggc
gtttcgtggggttatcatcacaggcaagggctgatggaggctgacgcccatcatatcctg
gaaaagccttccgatcttcatgctctattgctggaaatggaagaattctga

DBGET integrated database retrieval system