KEGG   Brucella melitensis bv. 1 16M: DK63_76Help
Entry
DK63_76           CDS       T03831                                 

Definition
(GenBank) glutamate-ammonia ligase adenylyltransferase family protein
  KO
K00982  [glutamine synthetase] adenylyltransferase / [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase [EC:2.7.7.42 2.7.7.89]
Organism
bmel  Brucella melitensis bv. 1 16M
Brite
KEGG Orthology (KO) [BR:bmel00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DK63_76
Enzymes [BR:bmel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.42  [glutamine synthetase] adenylyltransferase
     DK63_76
    2.7.7.89  [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase
     DK63_76
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnE GlnD_UR_UTase DUF294 XPC-binding RsbRD_N
Motif
Other DBs
NCBI-ProteinID: AIJ90211
UniProt: Q8YG35
LinkDB All DBs
Position
1:75365..78316
Genome map
AA seq 983 aa AA seqDB search
MTVENAKALFFERNLCALTPLDPERASAFLADLEARAREEELAGVVALLGRKKAADFLSA
ILDLSPFIREALTRQPRILDRIVSATPESALEAILDEISASGTVAGVSESELMTSLRQLK
REAHVLIALCDLARIFNTETTTDRLTDLAEACTGAAVRFLLLDADAAGRINLPDRSNPEK
DCGWIVLGMGKFGARELNYSSDIDLIVFIDETKPAIGDPYECVDTFSRLTRRLVRILQDR
TGDGYVFRVDLRLRPDPGSTPLAIPVGAALHYYEGRGQNWERAAMIKARPVAGDRLSGKQ
ILAELSPYVWRKYLDYAAIADVHSIKRQIHAHKGHGDIAVRGHNVKLGRGGIREIEFFVQ
TQQLIAGGRFPELRGNQTVPMLARLAERGWITQQARDALAQEYWFLRDVEHRIQMIADEQ
THILPEDDEGFARVSHMMGYADPAEFSEIFLAALKVVEKQYAALFEQAPELGAASGNLVF
TGDVDDPGTLETLSAMGYERSSDICRVIRTWHFGRYRATQSAEARERLTELTPALLKAFA
ETRRADESLLRFDGFLQGLPAGIQLFSLLQSNPRLLNLLVMIMSAAPRLADIITRNPHVF
DGLLDPAIFSEVPTRAYLEERLRAFLGSATDFEEVLDRLRIFAAEHRFLIGIRLLTGAIN
GVRAGQAFSDLAELMVGRALEAVEAELQRRHGKVKGAKVALLAMGKLGSRELTAGSDVDL
ILLYDHDKDAEESDGEKPLAPSKYYIRLTQRLIAALSAPTAEGVLYEVDMRLRPSGNKGP
VATHIEAFGKYQRNDAWTWEHMALTRARPIHGDEAFIARIKVDIEDVLAMPRDVRKLAGD
VREMRELIAQEKPPRDDWDLKLKPGGIIDLEFIAQFATLAGYVKKTPRPFATEEVLANLD
PFFADPAMVDGLVEAHRFYTNLSQAIRLCLNDSAGLDQFPPGMRELLCRVAGLPDIERIE
YELLEHYRLVRAAFDKLVGHGAD
NT seq 2952 nt NT seq  +upstreamnt  +downstreamnt
atgacggttgaaaacgcaaaggcactgtttttcgagagaaacctttgtgcattgacaccg
cttgatcctgaaagggcatctgcctttctggctgatctggaagcccgtgcccgcgaggaa
gagcttgccggcgtcgtggcgctgcttggccggaaaaaggcggcggattttctttcagcc
atcctcgatctttcgcctttcatccgcgaggcgctgacgcgccagccgcgcattctggat
cgtatcgtttccgcaacgccggaaagcgcacttgaggctattctggacgaaatttccgcc
agcgggaccgtcgcgggtgtcagcgaaagcgaactgatgacaagccttcgccagttaaag
cgtgaggcccatgtgctgattgccctttgcgatctggcgcgcattttcaatacggaaaca
accaccgaccggctgaccgaccttgcggaagcctgcacaggtgcagccgtccgctttcta
ttgctcgatgccgacgcggctggcaggatcaatctgccggatcgcagcaatccggaaaag
gattgtggctggatcgttcttggcatgggcaagttcggcgcgcgcgagctcaactattct
tccgatatagatctgattgttttcattgatgaaaccaagcctgctatcggcgatccctat
gaatgtgtcgatacgttttcgcggctgacgcggcggctggtgcgcatcttgcaggaccgc
accggcgatggttacgtcttccgtgtcgatctgcgtctgcggcctgatccgggatcgacg
ccgcttgccattccggttggcgctgcgctgcattattatgaggggcgtggccagaactgg
gagcgcgccgccatgataaaggcgcggcccgttgccggagatcgcttgtccggcaaacag
attttggcggaactgtcgccctatgtctggcgcaaatatctcgactatgcggcaattgcc
gatgtccattcgatcaagcgccagattcacgcccataagggccacggcgatattgccgtg
cgcgggcataatgtgaagcttggccggggcggtatccgggagatcgaattttttgtccag
acgcagcaattgattgcgggcgggcgctttcccgaactgcgcggcaaccagactgtgccg
atgctggcgcggcttgccgaacggggatggataacgcaacaggcgcgcgatgcgctggcg
caggaatattggtttctccgcgatgtcgaacaccgtatccagatgattgcggacgagcag
acccatatcctgcctgaagatgatgaagggtttgcccgcgtttcccatatgatgggttat
gccgacccggcggaattttccgaaatattcctcgccgcgctcaaggtggtggaaaagcag
tatgcggcgctgttcgagcaggcgccggaactgggcgcggcgagcggcaaccttgttttt
accggcgatgtggatgatccgggcacgctggaaacgctttctgccatgggctacgagcgc
tcaagcgatatctgccgcgtgatccgcacctggcatttcgggcgttatcgcgccacgcaa
tcggcggaagcacgggagcgcctcaccgaactgacgcccgcacttctcaaagcctttgca
gaaaccaggcgggcggatgaatcgcttctgcgcttcgacgggtttttgcagggcttgccg
gccggtattcagcttttcagcctgctgcaatccaatccccggcttttgaacctcctcgtg
atgatcatgagcgcggccccgcggctggcggacatcatcacacgcaacccgcatgttttt
gatgggttgctcgatccggccattttttcggaagtgccaacgcgtgcctatctcgaagaa
cgcctgcgggcatttctgggcagcgccacggatttcgaggaagtactggacaggctgcgt
atttttgctgccgaacatcgcttcctcatcggcatccgcctgctgacgggagcaatcaat
ggcgtgcgggccggacaggccttttccgatcttgccgaacttatggttggcagggcgctg
gaggcggtggaagccgaattgcaacgccgccatggcaaggtgaagggcgcgaaagtggcg
ctgctcgccatgggtaagcttggcagtcgcgaactgacggcgggctcggatgtggacctg
atcctgctttacgatcacgacaaggatgccgaggaatccgatggtgaaaagccgcttgcg
ccttcaaaatattatattcgcctgacacagcgcctcatcgcggccctttcggccccgacg
gcggaaggtgtgctttacgaggtggatatgcggctgcgcccgtcgggcaacaaaggcccc
gtcgcaacgcatatcgaagctttcggcaaatatcagcgcaacgatgcgtggacctgggaa
catatggcgctgacccgcgcgcggcccatccatggcgatgaggcttttatcgctcgcatc
aaggtggatatcgaggacgttctcgcgatgccgcgcgatgtgcggaaacttgccggggat
gtgcgcgagatgagggaactgatcgcgcaggaaaagccgccgcgggatgattgggactta
aagctgaagcccggcggcattatcgatctagagtttatcgcccaatttgcaacccttgcc
gggtatgtgaagaaaacgccgcgtccatttgcaaccgaagaagtgctggcaaaccttgat
ccattctttgcagaccctgcaatggtggatggccttgtggaggcgcatcgcttctacacc
aatctcagccaggcgatacggctttgcctgaacgatagcgcagggctggatcaatttccg
cccggtatgcgtgagctcctgtgccgcgttgccggattgccggatattgaacgcatagaa
tatgagttgctggaacattacaggcttgtcagggctgcttttgacaagctcgtcggacat
ggcgctgattga

DBGET integrated database retrieval system