KEGG   Brucella melitensis bv. 1 16M: DK63_844Help
Entry
DK63_844          CDS       T03831                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bmel  Brucella melitensis bv. 1 16M
Pathway
bmel00473  D-Alanine metabolism
bmel00550  Peptidoglycan biosynthesis
bmel01100  Metabolic pathways
bmel01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bmel00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DK63_844
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DK63_844
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    DK63_844
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bmel01011]
    DK63_844
Enzymes [BR:bmel01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DK63_844
Peptidoglycan biosynthesis and degradation proteins [BR:bmel01011]
 Precursor biosynthesis
  Amino acid ligase
   DK63_844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 GARS_A
Motif
Other DBs
NCBI-ProteinID: AIJ90154
LinkDB All DBs
Position
1:complement(854370..855296)
Genome map
AA seq 308 aa AA seqDB search
MTGKHVAVLMGGFSSERSVSLSSGVACATTLEECGYRVTRIDVDRNVASILVELKPDVVF
NALHGPFGEDGAIQGVLEYLQIPYTHSGVLASALAMDKDRAKKVAAAAGVVVAPSRLMNR
FDIGSQHPMKPPYVVKPVREGSSFGVVIVKEDQPHPPQVIGSADWKYGDEVMVEGYIAGR
ELTCAVMGDRAMDVCEIMPVGYQFYDYDSKYVAGASTHVCPAKILPNIYQKIQTMALTAH
RAIGCRGVSRSDFRFDDRFSEEGEVVWLEINTQPGMTPTSLVPDIAKAAGISFAELLSWM
VEDASCLR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgacgggaaaacacgtcgccgttttgatgggtggtttttcttcggaacgctccgtcagc
ctttcctccggtgtggcctgtgcaacgacgcttgaagaatgcggctatcgcgtcacgcgc
attgatgtggatcgcaatgttgcgagcatcctggtcgagttgaaacccgatgttgtgttc
aacgccttgcacggccccttcggcgaagatggcgccattcagggcgtgcttgaatatctc
cagattccctacacacattccggcgtgctggcttccgcgcttgcgatggacaaggatcgc
gccaagaaggtggcggcagcggcgggcgtcgtggttgcgccgtcacgcctgatgaaccgt
ttcgacattggttcgcagcatccgatgaagccgccttacgtggtgaagccggtgcgtgaa
gggtcgagcttcggtgtggtgatcgtcaaggaagatcagccgcatccgccgcaggtcatc
ggttcggccgattggaaatatggtgatgaggtcatggtcgaaggctatattgccgggcgt
gagctgacctgtgccgtgatgggggatcgcgccatggatgtgtgcgagatcatgccggtc
ggttatcagttctacgactatgattcaaaatatgttgcaggtgcatcaactcacgtgtgc
ccggcaaaaattttaccaaatatttaccaaaaaatacaaacaatggcccttacggcgcat
cgggcaatcgggtgtcggggcgtaagccggtcggacttccgtttcgatgatcgtttttct
gaagaaggcgaagttgtctggctggaaatcaatacccagccggggatgactcctacctcg
ctcgtgcctgatatcgccaaagcggcgggtatctctttcgctgagttgttgagttggatg
gtggaggacgcgtcttgtttgcgttga

DBGET integrated database retrieval system