KEGG   Bacillus methanolicus: BMMGA3_00400Help
Entry
BMMGA3_00400      CDS       T03209                                 

Gene name
hslO
Definition
(GenBank) 33 kDa chaperonin
  KO
K04083  molecular chaperone Hsp33
Organism
bmet  Bacillus methanolicus
Brite
KEGG Orthology (KO) [BR:bmet00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bmet03110]
    BMMGA3_00400 (hslO)
Chaperones and folding catalysts [BR:bmet03110]
 Heat shock proteins
  HSP33
   BMMGA3_00400 (hslO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AIE58598
UniProt: I3EC55
LinkDB All DBs
Position
81192..82070
Genome map
AA seq 292 aa AA seqDB search
MNDYLVKALAFNGQIRAYAVRSTETVGEAQRRHGTWPTASAALGRAMTAGVMMGAMLKGE
EKLTIKIEGGGPIGAILVDSNAKGEVRGYVTNPQVHFDLNEHGKLDVRRAVGTEGTLTVV
KDIGMRDYFTGQVPIVSGELGEDFTYYFASSEQVPSSVGVGVLVNPDNTILASGGFVLQL
MPGTDDQIITRIENRLKEIPPVSKLIEKGLTPEEILYELLGEENVKILETLPVSFTCNCS
KERFGNAIISLGQEEITDMIENEGKAEAQCHFCNNIYVYSKEELEELREEAK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattatttagtaaaggctctggcgtttaacggacagataagagcgtatgcagtt
agaagtacagaaacggtaggagaggcacaaagacgccatggaacttggcctacagcatct
gcagcattgggtagagcgatgacagccggtgtgatgatgggggcaatgttaaaaggtgaa
gaaaaacttacgataaaaattgagggtggcggaccaatcggagctattttagttgacagc
aacgcaaagggagaagtgcgcggttatgtaacgaatccccaagtccattttgatttgaat
gaacacggcaagcttgatgtaagaagagctgttggaacggaagggactcttacggttgtt
aaagatattggcatgcgtgattattttacaggacaagttcccattgtttcaggagagtta
ggtgaagattttacttattactttgcttcctcagaacaagtcccatcttctgttggtgtt
ggcgtgcttgtcaatccggataatactattttagcttcaggcgggtttgttttgcagctt
atgccaggaacagatgatcaaattattacaaggattgaaaatcggttaaaagaaattcca
ccagtatcaaaactaattgaaaaaggcttaactcctgaagagatattgtatgaactatta
ggagaagaaaatgtaaaaatccttgaaacgctgcctgtatcctttacatgtaattgttca
aaagagagatttgggaatgcgattattagccttggccaagaagaaattactgatatgatt
gaaaatgaaggaaaagctgaagcgcagtgccatttttgcaataatatttatgtgtactcg
aaagaggaattagaagaactgagggaagaagcgaaataa

DBGET integrated database retrieval system