KEGG   Bacillus methanolicus: BMMGA3_01290Help
Entry
BMMGA3_01290      CDS       T03209                                 

Gene name
alr
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bmet  Bacillus methanolicus
Pathway
bmet00473  D-Alanine metabolism
bmet01100  Metabolic pathways
bmet01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bmet00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BMMGA3_01290 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BMMGA3_01290 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bmet01011]
    BMMGA3_01290 (alr)
Enzymes [BR:bmet01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BMMGA3_01290 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bmet01011]
 Precursor biosynthesis
  Racemase
   BMMGA3_01290 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AIE58748
UniProt: I3E3S3
LinkDB All DBs
Position
237338..238501
Genome map
AA seq 387 aa AA seqDB search
MEGQVLFFRDTWAEVDLDKIANNIKAINEVLPSGTEMIAVVKANAYGHGDMQVAETALQA
GASYLAVAFLDEAIVLRKKGITAPILVLGASRPEDVKLAAEKKITLTVFQEDWIKKAQDF
LDQNEKLKIHIKLDTGMGRIGIRSKEELKAIESLILNDERLLFEGVYTHFATADELDSSY
FEKQLERFNQMIEWLEVRPRYVHSSNSAAALRFPAASFNAVRIGIAMYGLSPSPEIEPQL
PVVLKEAFSLHSRLVHVKKLQKGDKVSYGATYEASGEEWIGTLPIGYADGWIRKLQGQEV
LVEGIRAPIVGRICMDQCMIRLPYYVPPGTKCTLIGRQKEEFISVNEIAQKLETINYEIP
CIISSRVPRIYKRNGETIDINNSLLNK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
ttggaaggtcaagttttattttttcgtgatacatgggcggaagtggatttagataaaata
gcgaataatattaaggcaattaatgaggttttgccatctggaacagaaatgattgcagtt
gttaaggcgaatgcttatggccatggagacatgcaggtagctgaaacagctcttcaggca
ggagcttcctacctcgcagttgcatttttagatgaagcaatcgtattaagaaagaaaggg
ataaccgcacctattcttgttctaggagcaagccgccctgaagatgtcaaattggcagca
gaaaaaaagataacactgacagtatttcaggaagactggataaagaaagcgcaggacttt
ctagatcaaaatgaaaaattaaaaattcatataaaacttgatacagggatggggagaatt
ggaatccgcagcaaagaggagctaaaagctatagagtctttgatcctgaatgatgaacgg
ttgctttttgagggggtatatactcattttgcgacagctgatgaattggattcatcttat
tttgaaaaacagctcgagcggttcaatcaaatgatcgaatggttagaggtgcgtccgcgt
tacgttcattcaagcaacagtgccgctgcactccggtttccagcagcttcatttaatgcg
gtgcgcatcgggattgcgatgtatggtttatccccatccccggagattgaacctcagctt
cctgtcgttttaaaggaagctttttcactgcattcaaggcttgtccatgtcaaaaaactt
caaaagggtgataaagtaagctacggcgcaacttatgaagcttcaggggaagaatggatc
ggcactcttccgatcggctatgctgatggctggataagaaaattgcagggacaggaagta
ttggtagaaggaatccgggcgccgattgtcgggcgcatatgcatggatcagtgtatgatt
aggctgccatattatgttccgcccgggaccaaatgtacgttaatcggccggcaaaaagaa
gagtttatttctgtgaatgaaatagctcaaaagcttgaaacgattaattacgaaattcct
tgcattatttcgtcccgggttccgagaatttacaaacggaatggagaaacaatcgatata
aataattctcttctgaataaataa

DBGET integrated database retrieval system