KEGG   Bacillus methanolicus: BMMGA3_05305Help
Entry
BMMGA3_05305      CDS       T03209                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bmet  Bacillus methanolicus
Pathway
bmet00010  Glycolysis / Gluconeogenesis
bmet00020  Citrate cycle (TCA cycle)
bmet00620  Pyruvate metabolism
bmet01100  Metabolic pathways
bmet01110  Biosynthesis of secondary metabolites
bmet01120  Microbial metabolism in diverse environments
bmet01130  Biosynthesis of antibiotics
bmet01200  Carbon metabolism
Module
bmet_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bmet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMMGA3_05305 (pdhC)
   00020 Citrate cycle (TCA cycle)
    BMMGA3_05305 (pdhC)
   00620 Pyruvate metabolism
    BMMGA3_05305 (pdhC)
Enzymes [BR:bmet01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BMMGA3_05305 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N HlyD_3 HlyD_2 GCV_H DUF896 PTS_IIB
Motif
Other DBs
NCBI-ProteinID: AIE59491
UniProt: I3DYU4
LinkDB All DBs
Position
1040183..1041541
Genome map
AA seq 452 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFVKPGDKVQEDDVLCEVQNDKAVVEIPSPVAGTVEKIL
VEEGTVATVGQVLITFDAPGYENLKFKGDESVEEVPKKNEKTEAQAQTSSESGQDVKKDA
NREESKGAVKAESPVKTEVDPNRRVIAMPSVRKYARDNGVDIRLVAGSGKNGRILKEDID
AFLKGGQVKDETLKADQDQTVKPQIEANAAPAPAVPQGQYPETREKMSGIRRAIAKAMVN
SKHTAPHVTLMDEVDVTKLVAHRKKFKEIAAEKGIKLTFLPYVVKALTSALREYPVLNTS
LDDATEEIIYKHYYNIGIAADTDRGLLVPVVKDADRKSIFHISKEINDLATKAREGKLTP
DEMKGASCTITNIGSAGGQWFTPVINHPEVAILGIGRIAEKPVVKDGEIVAAPVLALSLS
FDHRLIDGATAQHALNHIKRLLNDPELLLMEA
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaattgcctgacattggtgaaggtattcatgaaggtgaaatcgtc
aagtggtttgtaaagccaggtgacaaagttcaggaagatgacgttttatgtgaagtacaa
aatgataaagcagtagtagaaattccttctccggttgcaggtacggttgaaaaaatatta
gttgaagaaggtactgtggctactgtcggacaagttttgatcactttcgatgctccgggc
tatgagaatttgaaatttaaaggcgacgaaagtgtagaagaagtgccaaagaaaaatgaa
aagacagaagctcaagcacaaacaagctcagaatccggacaggatgttaaaaaagatgca
aatagggaagaatcaaaaggtgcagttaaagcagagtctcctgttaagacagaggtcgat
cctaaccgtcgtgtgatcgcaatgccttctgttcgcaaatatgcccgcgacaatggtgtt
gatattcgtcttgttgctggttccggtaaaaacggacgtatcttaaaagaagatattgat
gcattcttaaaaggcggtcaggttaaagatgaaacactgaaagcggatcaagatcaaaca
gttaaaccacaaatagaagcaaatgcagcaccggcaccagctgttccacaaggtcaatat
ccggaaacacgagaaaaaatgagcggaattcgcagggcaatcgccaaagccatggtaaac
tctaaacatacggctccacatgttacacttatggacgaagtagatgtaacaaaacttgtt
gcccaccgcaagaaattcaaagaaatcgcggcagaaaaaggtattaagcttacattcctg
ccgtatgtggtaaaagcattaacaagtgctttacgtgaatatccagtattaaatacttca
cttgatgacgcaacagaagaaattatctataaacattattataatatcggaattgctgca
gatacagacagaggtttattagttccggtagtgaaagatgctgaccgcaaatcaatattc
catatttcaaaagaaatcaatgatttggcaacaaaagcccgtgaaggtaaattgacgcca
gatgaaatgaaaggcgcttcatgtacaattacaaatatcgggtcagccggcggtcaatgg
tttacaccggttattaaccatcctgaagtggccatcctcggaatcggccgaattgctgaa
aaacctgtagtaaaagatggcgaaattgttgcagctccagtattggctttatcgttaagc
tttgaccacagattgattgacggtgcaacagctcaacatgcattaaaccacattaaacgt
ttattgaacgatccagaactattgctaatggaggcgtaa

DBGET integrated database retrieval system