KEGG   Bacillus methanolicus: BMMGA3_11015Help
Entry
BMMGA3_11015      CDS       T03209                                 

Gene name
sodF
Definition
(GenBank) putative superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bmet  Bacillus methanolicus
Brite
Enzymes [BR:bmet01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BMMGA3_11015 (sodF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIE60599
UniProt: I3EA36
LinkDB All DBs
Position
complement(2187236..2188126)
Genome map
AA seq 296 aa AA seqDB search
MSGFKDYVKNVYTWNNQLREFLETEQVDKDEEIWSRLDTFTEIIEGIHHPLSPEEFARLQ
LQVEELHGEMERYFAERQQVGSIWISEPSVATGKHQLPPLPYQYNALEPYISEEIMRLHH
DQHHRSYVEGLNKAETALEKARESGDLSFVKHWSRELAFHGSGHYLHTIFWNNMSPNGGG
RPKGKLLTEIEKYFGSYETFKKQFSEAAKQVEGVGWALLVWSPRSRHLEILQSELHMILT
QWDTIPLLVLDVWEHAYYLQYKNRRAEYVKNWWKIVNWRDVEERFDKAEKLKWRPF
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgagtggatttaaagattatgtgaaaaacgtatatacgtggaataatcagctgagagaa
tttttggaaaccgaacaagtcgataaagatgaagaaatctggtcgaggcttgatacgttc
acagaaattatcgaggggattcatcacccactttcaccagaagaatttgcccgtcttcag
ttacaagttgaagaactgcacggtgaaatggaacgatattttgccgaaagacagcaggta
gggtctatttggataagtgaaccatcagtagcaaccggaaaacatcaattgcctccattg
ccttaccaatataacgctttagagccctacatctcggaagagataatgagacttcatcat
gatcagcaccaccgttcttatgttgaaggattgaacaaagctgaaacagctttggaaaaa
gcaagagaatcaggggatttatcgtttgtaaaacactggtcaagggaacttgcatttcat
ggatcaggccattatttgcatacgattttttggaataacatgagcccgaatgggggagga
aggccaaaagggaaacttctgacagaaattgaaaaatattttggaagctatgaaactttt
aaaaagcaattttctgaagctgccaaacaagtagaaggtgttggctgggcacttcttgtt
tggtctccaaggtcacggcatttggaaattctacaatccgagctgcacatgatattgact
cagtgggataccattcctctccttgtccttgatgtttgggagcatgcctattatttgcaa
tataagaaccggcgtgctgagtatgttaagaattggtggaaaattgtaaactggcgcgac
gttgaagaacggtttgataaagctgaaaaactaaaatggagaccgttttaa

DBGET integrated database retrieval system