KEGG   Bacillus methanolicus: BMMGA3_11575Help
Entry
BMMGA3_11575      CDS       T03209                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
bmet  Bacillus methanolicus
Pathway
bmet00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bmet01100  Metabolic pathways
bmet01110  Biosynthesis of secondary metabolites
bmet01130  Biosynthesis of antibiotics
bmet01230  Biosynthesis of amino acids
Module
bmet_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bmet00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BMMGA3_11575 (aroK)
Enzymes [BR:bmet01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     BMMGA3_11575 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18
Motif
Other DBs
NCBI-ProteinID: AIE60711
UniProt: A0A068LSH2
LinkDB All DBs
Position
complement(2298077..2298382)
Genome map
AA seq 101 aa AA seqDB search
MPVNRSIITTGGGIVLKEENRRWMKENGVVVFLYAEPEEIFKRIENDDSRPLLKTNKKAA
IKELFQARLSLYKEAADFTIDTTGKDITEIIKEIEEGLTKE
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgccagtaaatcgttcgatcattacaaccgggggaggcattgtacttaaggaggaaaac
cgcaggtggatgaaggaaaatggggttgtcgtgtttttatatgccgaaccggaggaaatt
tttaaacgaatcgaaaatgatgattctaggcctttgctaaaaacgaataaaaaagccgca
atcaaagaactttttcaggcgcgcctttctttatacaaagaagcagccgattttacaatt
gatacaaccggaaaggatatcaccgagattataaaagaaatagaggaaggtttaacaaag
gaatga

DBGET integrated database retrieval system