KEGG   Bacillus methanolicus: BMMGA3_12355Help
Entry
BMMGA3_12355      CDS       T03209                                 

Definition
(GenBank) hypothetical protein
Organism
bmet  Bacillus methanolicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Post_transc_reg DUF3475
Motif
Other DBs
NCBI-ProteinID: AIE60864
UniProt: I3EAV7
LinkDB All DBs
Position
complement(2452320..2452616)
Genome map
AA seq 98 aa AA seqDB search
MNVGHEYDRFRTLVKPALESKLNEFRLLGYEKITEQELWDFLTKKKWKKVREEIHLYQIV
QEILSVQVNEYMNFATVEAFKLTDFDINSEESRKELLK
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtcggccatgaatatgatcgttttcgcacattagtaaaacctgcattggaaagc
aaattgaacgaatttcgattgctcggttatgaaaaaattaccgaacaggaattatgggac
tttttaacaaaaaagaaatggaagaaagttcgggaggaaatccatctctatcaaattgtt
caggaaatcttgtctgtccaagtgaacgaatatatgaattttgctactgttgaagctttt
aaactgactgattttgatataaatagtgaggaatctagaaaagaacttttgaaataa

DBGET integrated database retrieval system