KEGG   Bacillus methanolicus: BMMGA3_14395Help
Entry
BMMGA3_14395      CDS       T03209                                 

Gene name
gcvH
Definition
(GenBank) Glycine cleavage system H protein
  KO
K02437  glycine cleavage system H protein
Organism
bmet  Bacillus methanolicus
Pathway
bmet00260  Glycine, serine and threonine metabolism
bmet00630  Glyoxylate and dicarboxylate metabolism
bmet01100  Metabolic pathways
bmet01110  Biosynthesis of secondary metabolites
bmet01130  Biosynthesis of antibiotics
bmet01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BMMGA3_14395 (gcvH)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMMGA3_14395 (gcvH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_H Biotin_lipoyl RnfC_N
Motif
Other DBs
NCBI-ProteinID: AIE61237
UniProt: I3DUF9
LinkDB All DBs
Position
complement(2844147..2844530)
Genome map
AA seq 127 aa AA seqDB search
MNTPKELRYSEEHEWVKVEGDKVRVGITDFAQSELGDIVFVELPEVGAEVTANEPFGSVE
SVKTVSELYAPISGKVVEINEELNDNPEFVNESPYEKAWMIVIEPSDLSEVDNLMTAEQY
EEMIKED
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaccaaaagaactgcgttattctgaagagcatgagtgggtaaaagtagaaggg
gataaagtgcgtgttggaatcactgactttgcacagtctgaacttggggacattgtattt
gttgaacttcctgaagttggagctgaagtgacagcaaatgagccatttggaagtgttgaa
tctgttaaaactgtatctgaattatatgcgccgattagcggcaaggttgtagaaataaat
gaagaattgaatgacaaccctgaatttgtaaatgaatctccatatgaaaaagcatggatg
attgtaatcgaaccatctgatctaagcgaagttgacaacttaatgaccgctgaacaatat
gaagaaatgattaaagaagattaa

DBGET integrated database retrieval system