KEGG   Bacillus methanolicus: BMMGA3_14440Help
Entry
BMMGA3_14440      CDS       T03209                                 

Definition
(GenBank) hypothetical protein
Organism
bmet  Bacillus methanolicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2573 Med15_fungi NAAA-beta DUF3106 Dynamin_M COMP
Motif
Other DBs
NCBI-ProteinID: AIE61246
UniProt: I3DUE9
LinkDB All DBs
Position
complement(2854641..2854892)
Genome map
AA seq 83 aa AA seqDB search
MEEKFYEQFDALLTKYTELLIGDTNDELKEKVKIWALYTHIAKSMPPLAKHWNELYPDAK
EEMKQLVREIKQLNEAHRAKKNG
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
ttggaagaaaaattttacgagcaatttgatgctttgcttaccaaatatacagaactgtta
attggtgacacgaatgatgaattaaaagaaaaggtgaaaatatgggctttatacacgcac
attgctaaatcgatgccgcctcttgccaagcactggaatgaattatatccagatgcaaag
gaagaaatgaaacaactcgttcgagaaattaagcaattaaatgaagcccatcgtgcaaaa
aagaatggataa

DBGET integrated database retrieval system