KEGG   Brucella abortus 2308: BAB1_1257Help
Entry
BAB1_1257         CDS       T00304                                 

Gene name
tuf-2
Definition
(GenBank) Elongation factor, GTP-binding:ATP/GTP-binding site motif A (P-loop):Elongation factor Tu, C-terminal:Elongation factor Tu, d...
  KO
K02358  elongation factor Tu
Organism
bmf  Brucella abortus 2308
Brite
KEGG Orthology (KO) [BR:bmf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bmf03012]
    BAB1_1257 (tuf-2)
   03029 Mitochondrial biogenesis [BR:bmf03029]
    BAB1_1257 (tuf-2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmf04147]
    BAB1_1257 (tuf-2)
Translation factors [BR:bmf03012]
 Eukaryotic Type
  Elongation factors
   BAB1_1257 (tuf-2)
 Prokaryotic Type
   BAB1_1257 (tuf-2)
Mitochondrial biogenesis [BR:bmf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BAB1_1257 (tuf-2)
Exosome [BR:bmf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BAB1_1257 (tuf-2)
  Exosomal proteins of breast cancer cells
   BAB1_1257 (tuf-2)
  Exosomal proteins of colorectal cancer cells
   BAB1_1257 (tuf-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CAJ11213
UniProt: Q2YM08
LinkDB All DBs
Position
I:complement(1216056..1217231)
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERTKPHVNIGTIGHVDHGKTSLTAAITKFFGEFKAYDQIDAAPEERARGITIST
AHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPAIVVFLNKCDQVDDAELLELVELEVRELLSKYEFPGDEIPIIKGSALAALEDSSKE
LGEDAIRNLMDAVDSYIPTPERPIDQPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEV
EIVGIKATTKTTVTGVEMFRKLLDQGQAGDNIGALIRGVGREDVERGQVLCKPGSVKPHT
KFKAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGVVTLPAGTEMVMPGDNVAMDVTL
IVPIAMEEKLRFAIREGGRTVGAGIVSSIIE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagtaagtttgaacgtacgaagccccacgttaacatcggcacgattggtcac
gttgaccatggcaagacgtcgctgacggcggcgatcacgaagtttttcggcgaattcaag
gcgtatgaccagatcgacgccgcgcctgaagaacgcgcccgcggcatcacgatctcgacg
gcccacgtcgagtacgagaccgcaaaccgtcactatgcacacgtcgattgccccggccac
gccgactatgtgaagaacatgatcaccggcgctgcccagatggatggcgcgatcctggtg
gtttcggctgctgacggcccgatgccgcagacccgcgagcacatcctgcttgcccgtcag
gttggcgttccggcgatcgtcgtgttcctcaacaagtgcgaccaggttgacgatgcagaa
ctgctcgaactggttgaactggaagtgcgcgaacttctgtcgaagtacgaattccccggc
gacgaaatcccgatcatcaagggctcggctcttgctgctctggaagattcttccaaggaa
ctgggcgaagatgccatccgcaacctgatggacgcggttgacagctacattccgaccccg
gaacgcccgatcgaccagccgttcctgatgccgatcgaagacgtgttctcgatctccggc
cgtggtacggttgtgacgggtcgcgttgagcgcggtatcgttaaggtcggtgaagaagtt
gaaatcgtcggcatcaaggcgacgacgaagaccacggttaccggcgttgaaatgttccgc
aagctgctcgaccagggccaggctggcgacaacattggcgcgctgatccgcggcgttggc
cgtgaagacgttgaacgcggccaggttctctgcaagccgggttctgtgaagccgcacacc
aagtttaaggcagaagcctatattctgaccaaggacgaaggtggccgtcatacgccgttc
ttcaccaactaccgtccgcagttctacttccgtacgacggacgtgacgggtgttgtgacg
cttccggctggcacggaaatggtcatgcctggcgataacgtcgccatggacgttaccctg
atcgtgccgatcgccatggaagagaagcttcgcttcgctatccgtgaaggcggccgcacc
gtcggtgccggcatcgtttcgtcgatcatcgagtaa

DBGET integrated database retrieval system