KEGG   Brucella abortus 2308: BAB1_1447Help
Entry
BAB1_1447         CDS       T00304                                 

Definition
(GenBank) D-alanine--D-alanine ligase/VANA/B/C:D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bmf  Brucella abortus 2308
Pathway
bmf00473  D-Alanine metabolism
bmf00550  Peptidoglycan biosynthesis
bmf01100  Metabolic pathways
bmf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bmf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BAB1_1447
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BAB1_1447
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BAB1_1447
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bmf01011]
    BAB1_1447
Enzymes [BR:bmf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BAB1_1447
Peptidoglycan biosynthesis and degradation proteins [BR:bmf01011]
 Precursor biosynthesis
  Amino acid ligase
   BAB1_1447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 GARS_A
Motif
Other DBs
NCBI-ProteinID: CAJ11403
UniProt: Q2YLY8
LinkDB All DBs
Position
I:complement(1399711..1400637)
Genome map
AA seq 308 aa AA seqDB search
MTGKHVAVLMGGFSSERSVSLSSGVACATTLEECGYRVTRIDVDRNVASILVELKPDVVF
NALHGPFGEDGAIQGVLEYLQIPYTHSGVLASALAMDKDRAKKVAAAAGVVVAPSRLMNR
FDIGSQHPMKPPYVVKPVREGSSFGVVIVKEDQPHPPQVIGSADWKYGDEVMVEGYIAGR
ELTCAVMGDRAMDVCEIMPVGYQFYDYDSKYVAGASTHVCPAKILPNIYQKIQTMALTAH
RAIGCRGVSRSDFRFDDRFSEEGEVVWLEINTQPGMTPTSLVPDIAKAAGISFAELLSWM
MEDASCLR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgacgggaaaacacgtcgccgttttgatgggtggtttttcttcggaacgctccgtcagc
ctttcctccggtgtggcctgtgcaacgacgcttgaagaatgcggctatcgcgtcacgcgc
attgatgtggatcgcaatgttgcgagcatcctggtcgagttgaaacccgatgttgtgttc
aacgccttgcacggccccttcggcgaagatggcgccattcagggcgtgcttgaatatctc
cagattccctacacacattccggcgtgctggcttccgcgcttgcgatggacaaggatcgc
gccaagaaggtggcggcagcggcgggcgtcgtggttgcgccgtcacgcctgatgaaccgt
ttcgacattggttcgcagcatccgatgaagccgccttacgtggtgaagccggtgcgtgaa
gggtcgagcttcggtgtggtgatcgtcaaggaagatcagccgcatccgccgcaggtcatc
ggttcggccgattggaaatatggtgatgaggtcatggtcgaaggctatattgccgggcgt
gagctgacctgtgccgtgatgggggatcgcgccatggatgtgtgcgagatcatgccggtc
ggttatcagttctacgactatgattcaaaatatgttgcaggtgcatcaactcacgtgtgc
ccggcaaaaattttaccaaatatttaccaaaaaatacaaacaatggcccttacggcgcat
cgggcaatcgggtgtcggggcgtaagccggtcggacttccgtttcgatgatcgtttttct
gaagaaggcgaagttgtctggctggaaatcaatacccagccggggatgactcctacctcg
ctcgtgcctgatatcgccaaagcggcgggtatctctttcgctgagttgttgagttggatg
atggaggacgcgtcttgtttgcgttga

DBGET integrated database retrieval system