KEGG   Brucella melitensis M5-90: BM590_A0207Help
Entry
BM590_A0207       CDS       T01849                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bmg  Brucella melitensis M5-90
Pathway
bmg00564  Glycerophospholipid metabolism
bmg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BM590_A0207
Enzymes [BR:bmg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BM590_A0207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 NAD_binding_8 Mqo
Motif
Other DBs
NCBI-ProteinID: ADZ86151
LinkDB All DBs
Position
I:210649..212184
Genome map
AA seq 511 aa AA seqDB search
MVFAGRFSGYAMVQEKQFDIFIIGGGINGCGIARDAVGRGFTVGLAEMNDLASGTSSRAT
KLIHGGLRYLEHYEFRLVREALMEREVLWANAPHIIHPMRFVLPYHKGGLRPAWLLRLGL
FLYDHLGGRKKLPATRTLNMRTDKAGEPLKPLFTKAFEYSDCWVDDARFVALTARDAADR
GAKIATRTSVVAASRDGQGWTITLEDTGTGRRENVHARLLVNAAGPWADKVLQSVEGDRQ
LHNIRLVQGSHIVVRRKFSDPRAYFFQNNDGRIIFAIPYEDDFTLIGTTDQDYKGDPAKV
AITDSETDYLCQAASEYFREPVRREDIVWTYSGVRPLYDDGASKAQEATRDYVLKEDAPD
GLAPLINVFGGKLTTARKLAEHMLQKIEHRLGRKGAPWTHAAPLPGGDFEDVAFETELKK
LEAAYPFLDARRLFRLYGTRAYKLLGQASSLGDLGRHFGSDLYEAEVRYLVENEWARSAE
DILWRRTKLGLRLTAAEVAAVQGFVEPAIAA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
ttggtgttcgcaggccggttttcggggtacgccatggtgcaggaaaaacaattcgatatt
tttattataggtggcggcatcaatggctgcggcattgcccgtgatgcggtggggcggggc
ttcaccgttgggctggccgagatgaacgatctggcaagcggcacctcttcgcgcgcaacc
aagctcattcacggtggtttgcgctatctggaacattatgaattccggctggtgcgcgag
gcgctgatggagcgcgaggtgctgtgggccaatgcgccgcatatcatccatccgatgcgt
ttcgtgctgccttatcataagggcggcctacgtcccgcctggctgttgcggcttggcctg
tttctttacgaccatctgggcggccgcaagaagcttcccgccacgcgcacgctcaacatg
cgcaccgacaaggccggcgaaccgctgaaaccgcttttcaccaaggcttttgaatattcc
gattgctgggtggacgatgcgcgcttcgtggcgctcaccgcccgcgatgcggctgatcgc
ggcgcgaagatcgcgacccgaacgagcgtcgttgccgcaagccgcgacgggcagggctgg
accatcacactggaagataccggcaccggcaggcgtgagaacgtacacgcccgccttctg
gtcaatgccgccgggccgtgggccgacaaggttctgcaaagtgtggaaggcgaccggcaa
ttgcacaatatccgtctggtgcagggcagccatatcgtcgtgcgcaggaagttttccgac
ccgcgcgcctatttcttccagaacaacgacgggcgcatcatcttcgccattccttatgaa
gatgatttcaccctgattggcaccacggatcaggattataagggcgacccggccaaggtg
gcgatcaccgacagcgagaccgattatctctgccaggcggcaagcgaatatttccgcgag
ccggtgcgccgggaggatatcgtctggacctattccggcgtgcgcccgctctatgatgac
ggggccagcaaggcgcaggaggcaacccgcgactatgtgctgaaggaagatgcgccagat
ggtctggcgccgctcatcaatgttttcggcggcaagctcaccacagcacgcaagcttgcc
gaacatatgctgcagaaaatcgagcaccggcttggccgcaagggcgccccatggacccat
gcagcaccattgccaggcggggatttcgaggatgtggcttttgaaacggaactgaagaag
cttgaggcagcctatcctttccttgatgcgcgccgcctgttccggctctatggcacccgg
gcatataagcttttggggcaggcttcttcgctgggcgatcttggccgtcattttggcagc
gatctctatgaggcggaagtgcgctatcttgtcgaaaatgaatgggcgcgaagcgcggaa
gacattttgtggcggcgcaccaagctcggcctgcgcctgacggcggcggaagtcgcggcc
gtgcagggctttgtggagcctgcaatcgccgcctaa

DBGET integrated database retrieval system