KEGG   Brucella melitensis M5-90: BM590_B0887Help
Entry
BM590_B0887       CDS       T01849                                 

Definition
(GenBank) Alr, alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bmg  Brucella melitensis M5-90
Pathway
bmg00473  D-Alanine metabolism
bmg01100  Metabolic pathways
bmg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bmg00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BM590_B0887
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BM590_B0887
Enzymes [BR:bmg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BM590_B0887
Peptidoglycan biosynthesis and degradation proteins [BR:bmg01011]
 Precursor biosynthesis
  Racemase
   BM590_B0887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C DUF294_C
Motif
Other DBs
NCBI-ProteinID: ADZ89004
LinkDB All DBs
Position
II:887190..888389
Genome map
AA seq 399 aa AA seqDB search
MVEMSLPFSQDERDLAAGGILTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRV
APAFYEAGCRDFFVAHLGEAVALKPFLKPDATLYVLNGLQPGTEAACAREGILPVLNSLE
QVENWAALATRLGKKLPALLQFDTGMSRLGLSAKEFDRLLENVTLLSRIDIKFAISHLAN
GDEPGNAVNARQLAKMTALLARLPKLPAALANSGGTFLGKTYYFDLARPGIALYGIDPER
QHDFSDKVAHENKKPKHSILPVLTLSARVIQVRDVDKGATVGYGGTYVANGPMRIATIAV
GYADGLFRSLSNKGAAFFGDTRLPIIGRVSMDSITLDVTSLPEGTLKLGSLVEMIGPHQR
LEDVARDCDTIPYEILTALGNRYARVYVYVNGGGTSTTA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggttgagatgtctttacctttttctcaggatgagcgcgatctcgcggctggcggcata
ttgaccattgatctcgcagccctgcgccacaattattcagccatcgcaacccgcattgcc
ccaacccgtacggccgctgtggtaaaggcagacgcctatggcctgggcgcaagccgggtc
gcaccggctttctacgaggccggttgccgcgatttcttcgttgcacatcttggcgaagca
gtggcgctgaagccctttttgaaacccgacgcaacactttatgtcctgaacggccttcag
cccggaacggaagcagcctgtgcccgcgaaggcatcctgcctgttctcaattcgctggaa
caggttgaaaactgggcagcactcgccacccggctgggcaaaaaactgcccgccctgctc
cagttcgataccggcatgtctcgtcttggcctgtcagccaaggaatttgaccgccttctt
gagaacgtcacgctcctgagcaggatcgacatcaaattcgccatcagccatctggcaaac
ggcgacgagccgggaaatgcggtaaatgcccgtcagcttgccaagatgacggccttgctc
gctcgcctgccgaaactgccggctgccttggccaattccggcggcaccttcctcggcaag
acctattatttcgatctcgcccgccccggcatcgcgctatatggcatcgatccggagagg
cagcatgacttttcggataaggtggcgcacgagaataagaaacccaagcattcgatcctt
cccgtcctcaccctttcggcgcgtgtcattcaggtgcgcgacgtcgacaagggagcgaca
gttggctatggcggcacctatgtcgccaacggcccgatgcggattgcgacgattgcggtc
ggctatgctgacggcttgttccgttccttgagtaacaagggcgcagcctttttcggcgat
acgcgcctgcccatcatcgggcgcgtatcgatggattcgatcacgctcgacgtcacctca
ttgccggagggaacgctgaaactcggcagccttgtggaaatgatcggcccgcatcagcgc
ctcgaagacgtggcgcgggactgcgacactatcccctatgaaattctgactgcgcttggc
aaccgttatgcgcgcgtttacgtttacgtgaatggcggtggcaccagcacaacagcataa

DBGET integrated database retrieval system