KEGG   Bacillus megaterium WSH-002: BMWSH_0168Help
Entry
BMWSH_0168        CDS       T01890                                 

Gene name
yviF
Definition
(GenBank) Flagellar assembly factor fliW
  KO
K13626  flagellar assembly factor FliW
Organism
bmh  Bacillus megaterium WSH-002
Brite
KEGG Orthology (KO) [BR:bmh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bmh02035]
    BMWSH_0168 (yviF)
Bacterial motility proteins [BR:bmh02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    BMWSH_0168 (yviF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliW
Motif
Other DBs
NCBI-ProteinID: AEN87052
LinkDB All DBs
Position
175280..175702
Genome map
AA seq 140 aa AA seqDB search
MKISTSYHGDIEIDNQQTLTFNQGIPGFLDETEFVILPLPEAEAFQVLQSIQTKELAFII
TDPFQFFLDYDFQLEPQEIEKLQLQQAEDAAVYVMLTMSDSVEKITANLQAPVIINTKQQ
LAKQVILMNTAYETKHRLFE
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttcaacaagctatcatggagatatagaaatagataatcagcaaacactgaca
ttcaatcaagggattccaggttttttggatgaaactgaatttgttattttaccacttccg
gaagccgaagctttccaagttctgcagtctattcaaaccaaagaactcgcttttattatc
acggatccatttcagttttttttagattatgattttcaactagaacctcaggaaattgaa
aagcttcaattacaacaagcggaagatgcagctgtttacgtaatgcttacgatgtcagat
tctgtggaaaagataacggctaatttgcaggctcctgttattattaatacaaagcagcag
cttgctaaacaagtgattttaatgaatacagcttatgaaacgaagcacaggttatttgag
taa

DBGET integrated database retrieval system