KEGG   Bacillus megaterium WSH-002: BMWSH_0992Help
Entry
BMWSH_0992        CDS       T01890                                 

Definition
(GenBank) Serine/threonine protein kinase with PASTA sensor(S)
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bmh  Bacillus megaterium WSH-002
Brite
KEGG Orthology (KO) [BR:bmh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bmh01001]
    BMWSH_0992
Enzymes [BR:bmh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BMWSH_0992
Protein kinases [BR:bmh01001]
 Serine/threonine kinases: Other
  Bacterial family
   BMWSH_0992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kdo Kinase-like Haspin_kinase RIO1 DUF4366 ETRAMP DUF1676 PBP1_TM PBP_N
Motif
Other DBs
NCBI-ProteinID: AEN87876
LinkDB All DBs
Position
1012487..1014532
Genome map
AA seq 681 aa AA seqDB search
MLIGRRLNDRYKVLQVIGGGGMANVYLGRDMILDRDVAIKVLRLDFASDDAFIKRFHREA
QSATSIAHPNIVSIYDVGEEEDIYYIIMEYVPGMTLKQYILQESPLSLDKAIHIMTQITS
AIAHAHQYGIIHRDIKPQNILIDHDDTIKVTDFGIAVALSSTTITHTNSVLGSVHYLSPE
QARGGLANKRSDIYSLGIVLFELLTGRVPFSGESAVSIALKHLQTETPSPKRWNPSIPQS
VENVVLKATTKDPFYRYSSVEELEADLQSAVHPNRYNEQRFTVPDDEEVTKAIPVIKEDF
VESEETHVPVRKPPHLEREEQEEEELKPKKKKKKKKKGKSKLIVTLVLIFLLLAAASVAA
VTFIPALLLPKDVKVPDLHNQDYESAVTDLVSLGFKVKNPKDISDNEVEEGDVVKTMPEA
GDVIKEGSNVIIYRSTGKKKEAFNRYIGRSFTEVKNLLEKQNYKDIQSIEVESTEPKGNI
TDQTPKETEQVVPEDTTVTLWVSKGPPKITLKDFSGWTEKSVKDYASDEDIEVDVKTAYS
DTVEKGLVMSQKPAAEQSIEQGDKLTITVSMGKEPKAPQTVAVDVTIPYKEETDTEASTE
QGDTTETGDTTEAEEEKPKPQKVQIYIEDADNDMSVPAKELTITETTKESFDVLVNENEK
ASYKIVRDGEVIEEKDVEYPE
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
ttgctaataggtagacggctaaacgaccgttataaggtattgcaagtaattggtggaggc
ggaatggcaaacgtctatttaggtcgcgacatgattttagatcgtgatgtggcaattaaa
gtgcttcgtttagactttgcaagtgacgacgcgtttataaagcgtttccatcgagaagca
caatctgctacgagtattgctcatcctaatattgtcagtatttatgatgttggagaagaa
gaagatatttactatatcatcatggaatatgtaccgggtatgacattaaaacaatacatt
ctgcaagaatcaccactatctcttgataaagccatacatattatgacgcagattacatca
gctattgcccatgctcatcagtacggaattattcaccgggatattaagcctcaaaatatt
ttaattgatcatgatgataccattaaagttactgacttcggcattgccgtagcactaagt
tctacgaccattacgcatactaattctgttttgggctctgttcattatttatctcctgaa
caggcaaggggagggcttgcgaataagcgttctgatatttattcgcttggcatcgtccta
tttgaattgctaacgggtcgagtccctttttctggggaatcggctgtgtcaattgcatta
aaacatttacagacagaaacaccttctccaaaaaggtggaatccatctatccctcaaagc
gtggagaatgttgtattaaaagcaacaactaaagatccattttaccgatacagttccgtc
gaagaactcgaagcggatttacagtctgctgttcatccaaatcgttataatgaacaaagg
tttacggtgcctgatgatgaagaagtgacaaaagccattccagttattaaagaggatttt
gttgaatccgaagaaacgcacgtacctgtgagaaaaccacctcacttagagcgcgaagaa
caagaggaagaagagttaaagccgaagaaaaaaaagaagaaaaagaaaaaaggaaaaagc
aagcttatcgtaacgcttgttttaatttttttgctgctggcagctgctagcgtagccgcc
gttacatttattccggctttattactgccaaaagacgtaaaggttcctgatttacataat
caagattatgaatcagcagtaaccgatttagtttctttaggctttaaagtgaagaatcct
aaagatatatccgataatgaggtggaagaaggcgacgtggttaaaacgatgccagaagcg
ggcgacgttatcaaagaaggatctaatgtcattatttatcgaagtacaggaaagaaaaaa
gaagcatttaaccggtacattggaagaagctttacggaagtaaaaaatctgttagaaaag
cagaattataaagatatccaatccatcgaagttgaaagcacagaaccaaaaggcaatatt
acagatcagacgcctaaagaaaccgaacaagtcgtgccggaagatacaacggttacgcta
tgggtaagtaagggtccgccgaagattacattaaaggatttctcgggctggacggaaaaa
agcgtaaaagattatgcatcagatgaagatattgaagtggatgtaaaaacagcgtattcc
gatactgttgaaaaaggtcttgtgatgtctcaaaagccggcagcggagcagagtatcgag
caaggtgataagcttacaattacagtctcgatgggcaaagagccaaaggctcctcaaacg
gtagcagtggatgtgactatcccgtataaggaagagactgacaccgaagcaagcacggaa
caaggcgacacaacggaaacaggcgatactactgaagcagaagaggaaaagccaaaacca
caaaaagtacagatctatattgaggatgcagataacgatatgtccgttcctgctaaagaa
ctcacgattaccgaaacgacaaaagaatcgtttgatgttttagttaatgaaaatgaaaaa
gcgtcttataaaattgtccgagacggggaagttattgaagaaaaagacgttgaatatcca
gagtga

DBGET integrated database retrieval system