KEGG   Bacillus megaterium WSH-002: BMWSH_4332Help
Entry
BMWSH_4332        CDS       T01890                                 

Gene name
yneQ
Definition
(GenBank) Conserved protein YneQ
Organism
bmh  Bacillus megaterium WSH-002
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4031
Motif
Other DBs
NCBI-ProteinID: AEN91211
LinkDB All DBs
Position
complement(4082304..4082612)
Genome map
AA seq 102 aa AA seqDB search
MAFGIKRPELNAWKAAVKRGEIAFLTHYWLDERFPHATTVTKVGCSDLNKLIKWGKKYGI
PAKYIDNRSGYPHFDLLGERQKEIMKKENQLEQLKRFEEVKE
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atggcatttggaattaaacgcccggaactaaacgcatggaaagcagctgttaagcgagga
gagatcgcatttttaactcattattggcttgatgagcgttttccacatgcaactaccgta
acaaaagtaggttgcagtgacttaaataagctgattaagtggggaaaaaagtatggtatt
cccgctaagtatattgataatcgatccggctatcctcatttcgatttactaggcgagcgt
cagaaagaaattatgaaaaaggaaaatcagctggagcagctgaagcgatttgaagaagtt
aaagagtga

DBGET integrated database retrieval system