KEGG   Bacillus megaterium WSH-002: BMWSH_4350Help
Entry
BMWSH_4350        CDS       T01890                                 

Gene name
hxlA
Definition
(GenBank) 3-hexulose-6-phosphate synthase HxlA
  KO
K08093  3-hexulose-6-phosphate synthase [EC:4.1.2.43]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
bmh00030  Pentose phosphate pathway
bmh00680  Methane metabolism
bmh01100  Metabolic pathways
bmh01120  Microbial metabolism in diverse environments
bmh01200  Carbon metabolism
bmh01230  Biosynthesis of amino acids
Module
bmh_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
bmh_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bmh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BMWSH_4350 (hxlA)
  09102 Energy metabolism
   00680 Methane metabolism
    BMWSH_4350 (hxlA)
Enzymes [BR:bmh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     BMWSH_4350 (hxlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase 4HFCP_synth Ribul_P_3_epim PEP_mutase HcyBio ADH_zinc_N Abdominal-A
Motif
Other DBs
NCBI-ProteinID: AEN91229
LinkDB All DBs
Position
4100781..4101410
Genome map
AA seq 209 aa AA seqDB search
MELQLALDLVNISQAKEVVKEVEEHIDIVEIGTPVVINEGLRAVKEIKEAFPNLKVLADL
KIMDAAGYEVQQASQAGADIITILGVAEDMSIKGAVEEAKKQGKKILVDMIGVKDIKGRA
KELDEFGVDYICVHTGYDLQAVGQNSFEDLVTIKSVVKNAKTAVAGGIKLESLPEVVKAQ
PDLVIVGGGITSQDDKKSVASQMKELITN
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggaattacaattagcgttagatcttgttaatatttctcaagcaaaagaggtagtaaaa
gaagttgaagaacatattgatatcgtggaaatcggtacacctgttgtaatcaatgaaggg
cttcgcgccgttaaagaaattaaagaagcatttcctaatttaaaagtattagctgaccta
aaaatcatggatgcagctggttatgaagtacagcaagcttctcaagctggagcagacatc
attaccatcttaggtgtagctgaagatatgtcaattaaaggtgcagttgaagaagcgaaa
aaacaaggtaaaaaaattctagtcgatatgattggtgtaaaagatattaaaggacgcgca
aaagagctagacgaatttggcgttgactatatctgtgtacacacaggatacgaccttcaa
gcagttggccaaaactcttttgaagatttagtaacgatcaaaagcgttgtgaaaaatgca
aaaacagctgttgctggcggcattaaattagagtctttacctgaagtagtaaaagcacag
cctgatcttgttatcgttggcggaggaatcacgagccaagacgataaaaaatcagttgct
tctcaaatgaaagagcttattacaaattaa

DBGET integrated database retrieval system