KEGG   Bacillus megaterium WSH-002: BMWSH_4393Help
Entry
BMWSH_4393        CDS       T01890                                 

Definition
(GenBank) hypothetical protein
Organism
bmh  Bacillus megaterium WSH-002
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEN91272
LinkDB All DBs
Position
complement(4146853..4147359)
Genome map
AA seq 168 aa AA seqDB search
MGKLFLSPIGNEVLIMVLLILTTVISILSVLVMPKRISWIEIYTTSLFVMFLGSVADIYL
DVKYDLYGFFTKGVDFEYLLIFIFIYPATNSVFLNFYPQGKSLFRKALYITVWVILTTLF
EYISTQTEVFYYNGWKILYSFFCYPFLYIAMVLNLKMIRRLQVIDKQK
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagctgtttttatctcctataggaaacgaggtcctcattatggtgctcttaatc
cttacaacggtgatttctattctgagtgtactagttatgccaaagcgcatcagctggata
gaaatatacacaacgtctttgtttgtcatgtttttaggatcggtagcagatatatatctt
gatgttaaatatgatctttatggattttttacaaaaggagtagattttgaatatctttta
atttttatttttatttatcctgcgacaaatagtgtatttttgaatttttatccacaaggc
aagagtctgtttagaaaagctttatatattacagtgtgggtaattcttacgacattgttt
gagtacatttctacccaaacggaagtgttttattataatggatggaagattctatactcg
tttttttgctatccgtttctttatatagcaatggttttaaatttaaaaatgatacgcagg
ctccaggttatcgataagcaaaaatag

DBGET integrated database retrieval system