KEGG   Bacillus megaterium WSH-002: BMWSH_4395Help
Entry
BMWSH_4395        CDS       T01890                                 

Gene name
mmuM
Definition
(GenBank) Homocysteine S-methyltransferase ybgG
  KO
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
bmh00270  Cysteine and methionine metabolism
bmh01100  Metabolic pathways
bmh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BMWSH_4395 (mmuM)
Enzymes [BR:bmh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     BMWSH_4395 (mmuM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-methyl_trans
Motif
Other DBs
NCBI-ProteinID: AEN91274
LinkDB All DBs
Position
complement(4148236..4149171)
Genome map
AA seq 311 aa AA seqDB search
MNPIQQILHTFPVIVLDGAMATELERYGCDLNDSLWSAKVLMEQPELIKRVHQDYFAAGA
DCAITASYQSTFEGFAKRGLSEAEARELIQASVKIAAEARDEFWQQEENRLNRPKPIVAA
SVGPYGAFLANGSEYTGQYDVTEEELMEFHRPRMKALIEAGADVLACETIPNVMEARAIA
RLLEEFEGAYAWITFSAKDDLHISSGTLISECARYLNSYEQIAALGVNCTPPQYISSLIK
EIKSQTDKPVIVYPNSGEHYDAESKTWNGTSAGETYGCSAHSWYEAGAQLIGGCCRTTPD
DIKGITKWARK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctatccaacaaattttacatacatttcctgtgattgtactagatggtgcaatg
gcaactgaacttgaaagatatggctgtgatttaaacgacagcttatggtctgcaaaagtg
ttgatggagcagcctgaactgattaagagagtgcaccaagactactttgctgcgggagct
gactgtgcaattacagcaagttatcaaagcacatttgaaggttttgctaaacgtggcttg
agtgaagcagaggctcgcgagctaattcaagcatctgtaaaaattgcggctgaagcaaga
gatgaattttggcagcaagaagagaatcgtcttaatcgtccaaaaccaattgttgctgct
tcggtaggtccttacggagcatttttagcaaacggatcggaatatactggacagtatgac
gtaacagaagaagagttaatggaatttcatcgtcctcgtatgaaagcattaattgaagct
ggagcggacgtattagcttgtgaaaccattcctaatgtaatggaagcaagagccattgcg
aggctgctagaagaatttgaaggagcgtacgcatggattacgttcagcgcaaaagatgac
ctgcacattagcagcggaacattaatctcggagtgtgcccgctatctgaattcttatgag
caaatagcggctcttggagttaactgtacaccgcctcaatatatttcttcacttattaaa
gaaattaaatctcaaacggataagccagtcattgtgtatccaaattcaggggagcattat
gacgctgaatctaaaacatggaacggaacatctgcgggtgaaacctacgggtgcagcgct
cacagctggtatgaagcaggagctcagttaattggagggtgctgtcgcacaactccagat
gatattaaaggcattacaaaatgggctagaaaataa

DBGET integrated database retrieval system