KEGG   Bacillus megaterium WSH-002: BMWSH_4401Help
Entry
BMWSH_4401        CDS       T01890                                 

Definition
(GenBank) Putative HTH-type transcriptional regulator
Organism
bmh  Bacillus megaterium WSH-002
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_19 HTH_31 HTH_26 HTH_24 HTH_28 Sigma70_r4 HTH_25 HTH_Crp_2 Pou HTH_7
Motif
Other DBs
NCBI-ProteinID: AEN91280
LinkDB All DBs
Position
4154436..4154663
Genome map
AA seq 75 aa AA seqDB search
MIILTLINHVKELRAKHGYTQGDLAEKVGATRQTIAAIEKGNYVPSLLLGLTICDVFQLK
MEDVFTLQKEEKNVE
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
gtgatcatattgactcttattaatcacgtaaaagagcttagagctaaacatggatatacg
caaggagatttagctgaaaaagttggagccactcgccaaaccattgcagctattgaaaag
ggaaattacgttccctccctactacttggtttaacaatttgtgatgtctttcaattaaaa
atggaagatgtttttacacttcaaaaggaggagaaaaatgttgagtaa

DBGET integrated database retrieval system