KEGG   Bacillus megaterium WSH-002: BMWSH_4435Help
Entry
BMWSH_4435        CDS       T01890                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
bmh00620  Pyruvate metabolism
bmh00680  Methane metabolism
bmh01100  Metabolic pathways
bmh01120  Microbial metabolism in diverse environments
bmh01200  Carbon metabolism
Module
bmh_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bmh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMWSH_4435
  09102 Energy metabolism
   00680 Methane metabolism
    BMWSH_4435
Enzymes [BR:bmh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BMWSH_4435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase FXR_C1
Motif
Other DBs
NCBI-ProteinID: AEN91313
LinkDB All DBs
Position
complement(4184405..4187173)
Genome map
AA seq 922 aa AA seqDB search
MVTVEAAERQNSSTALRRDVKFLGQLLGKVLVHQGGEELLNKVEKIREVAKSLRENKDEA
IYKEIKNEIVTLEQPMREQVIRAFAVYFHLVNIAEQNHRIRRRREYQQQEDSIMQPGSLE
SAVVSLKNNGVAPDVIANLLQTLSLELIITAHPTEATRRSVLDIHKRMAELLKNLDNPTL
TKRERTEIEERLFSEVLILWQTNELRDRKPTVMDEVSNGLYYFDETLFEVLPQLHQELEN
SLKENYPEENWKVPNILRFGSWIGGDRDGNPNVTPKVTWQTLVKQRKLAIRKYKESLTQL
RQRLSQSTKRVAVSDNLLDSINQEISLLPEKKRWRIKHEVYRCKLTIMLHKLNLVGESEA
GYQRSEELLHDLFLIKDSLQKHQPQDYQLKSLCKLIRQVELFGFHLATLDIRNHSGEHEA
AIKEIFHAVSLAEDYSALTEEEKVKLLGKVLQDPRPVISFVENYSKETQQVIEVFNMIHR
AHKEFGERSIEVYLISMTQSASDLLEVMVLAKEAGIYRLHADGRIESKLNIAPLLETIDD
LTAGPKIMEQLFQLDFYREHLRKQQDLQEIMLGYSDGSKDGGTLTANWKLYKAQQEIHDM
ARKYQVRLKFFHGRGGSLGRGGGPLNRSILSQPVETLGDGVKITEQGEVLSSRYSLYDIA
YRSLEQAVSALLTAAANVSQEAEQCDIRTHEWEETMDEISTASLRKYQELVFKDPDFLTY
FKQATPLPELGALNIGSRPMSRKGSDRFEDLRAIPWVFAWTQSRQLLPAWYAAGTGLQHL
VEKSGDIQLLQQMYKEWPFFRSTVDNLQMALTKADLMAAKEYTEMVQDPVISERIFTAIK
TEYNVTKEMILQITGQKELMDHLPTIKESIKLRNPYVDPLTFLQVKVISKLREDEAETLN
EELLKEALLTINGIAAGLRNTG
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atggtaacagtagaagcagcagaaagacaaaacagcagcactgctctgcgccgtgatgta
aagtttctcggtcaattgttggggaaagttctggttcaccaaggtggagaagaactgctc
aacaaagtagaaaaaatacgcgaagtagcaaaatcacttagagaaaacaaagatgaagct
atctataaagaaataaaaaatgaaatcgttactcttgaacagccgatgcgcgagcaggtt
attcgggcgtttgcagtttattttcatttagttaatattgcagagcaaaatcatcgaatt
cgtcgcagacgcgaatatcagcagcaagaagattctattatgcagccgggctcattggaa
agtgccgttgtttcccttaaaaataatggcgtggcgccagacgtaattgctaacttgctt
caaactttatctctagagctcatcattacggctcatccaacagaagccactaggcgaagt
gttcttgatattcataaacgaatggctgagcttctgaaaaacttagataatccaacgtta
acaaaacgtgaacgtacggaaattgaagaaagactgtttagcgaagtgttgattttatgg
caaacaaatgagctgcgagatcgcaaaccaaccgtaatggatgaagtatccaatggatta
tattattttgatgaaacgttatttgaagtgcttcctcaacttcatcaggaattggaaaat
tccttgaaggagaattaccccgaagaaaattggaaggtgcctaatattcttcgatttggt
tcatggattggcggagaccgagatggaaatccaaacgtaactcccaaagtaacgtggcaa
acgcttgtcaaacaaaggaagttagctattcgtaaatataaagagtcgcttactcaattg
agacaaaggttaagtcagtctacaaaaagagtcgcagtttcagataaccttcttgattct
attaatcaagaaatatccctgctgcctgagaaaaagcgatggagaatcaaacacgaagta
taccgctgcaagcttacgattatgcttcataaattaaatttagttggagagtcagaagca
ggttatcaaaggtcggaagaacttctacatgatttatttctaatcaaagatagcttgcaa
aagcaccagcctcaggattatcagttaaaaagcttatgcaaattaattcgccaagttgag
ctgtttggttttcatttagcaacgcttgatatccgtaatcacagcggagaacatgaagcg
gcgatcaaagaaattttccatgctgtttctttagctgaagattattcagccttaacagaa
gaggaaaaagttaagctgctagggaaggtgcttcaagatccaagacctgtgatatcgttt
gtagagaattactccaaagaaacgcagcaagtaattgaagtatttaacatgattcatcga
gcacataaagaatttggagaaagatctattgaagtctatttaatcagtatgacccagtct
gcaagtgatttgttagaagtcatggtacttgccaaagaagcgggtatttatcgccttcat
gcagatggccgcattgaaagtaagttaaatatagctccgctgcttgaaacaatcgatgat
ctcacagcaggtcctaaaattatggaacagctatttcaattagatttttatcgagagcac
ttaagaaaacagcaggatttgcaagaaatcatgcttggctactcagatggaagcaaagac
ggaggaacgcttaccgctaattggaagctctacaaagcgcagcaggaaattcacgatatg
gcgaggaagtatcaagttcgtctgaagtttttccacggtcgaggcggctcactaggccga
ggaggtggcccgttaaaccgaagcattttatctcagcctgttgagacactaggagacggc
gttaaaattacagagcaaggagaagttctttcttctagatactctttatatgacattgct
taccgaagccttgagcaagcggtctcagctcttcttacagcggcagcaaatgtttctcaa
gaagctgaacaatgtgatattcgtacacatgaatgggaagaaacaatggacgagatttca
actgcttcattacgtaaatatcaagagcttgttttcaaagatccagactttttaacgtat
tttaaacaagctacacctcttcctgagctgggggctttaaatattgggtcacgtccaatg
agtcgaaaaggaagtgatcgctttgaagacttacgagcgattccgtgggtatttgcatgg
actcaaagcagacagctgcttccagcctggtacgctgcaggtacgggcttacagcactta
gtagagaaatccggagatatacagcttcttcagcaaatgtataaagaatggccatttttc
cgctcgaccgtcgataatctgcaaatggccttaacaaaagcagatttaatggcagcaaaa
gaatatacggaaatggtacaagacccggttatttcagagcggatttttaccgctattaaa
acagagtataatgttacgaaagaaatgattcttcaaatcacgggtcaaaaagaattaatg
gatcatcttcctacgattaaagaatctattaaattacgaaatccgtatgtggaccctcta
accttcttacaagttaaggtcatttccaagctgcgtgaagatgaggctgaaacgttaaat
gaagaacttttaaaagaagcgttattaacgattaacggcattgcagcagggttgcgtaac
acaggttga

DBGET integrated database retrieval system