KEGG   Bacillus megaterium WSH-002: BMWSH_4446Help
Entry
BMWSH_4446        CDS       T01890                                 

Gene name
glnK
Definition
(GenBank) Sensor histidine kinase glnK
  KO
K07717  two-component system, sensor histidine kinase YcbA [EC:2.7.13.3]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
bmh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BMWSH_4446 (glnK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bmh01001]
    BMWSH_4446 (glnK)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bmh02022]
    BMWSH_4446 (glnK)
Enzymes [BR:bmh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BMWSH_4446 (glnK)
Protein kinases [BR:bmh01001]
 Histidine kinases
  Other
   BMWSH_4446 (glnK)
Two-component system [BR:bmh02022]
 Other families
  GlnK-GlnL (glutamine utilization)
   BMWSH_4446 (glnK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HATPase_c_5 HATPase_c_3 HATPase_c_2 dsDNA_bind
Motif
Other DBs
NCBI-ProteinID: AEN91324
LinkDB All DBs
Position
4197093..4198343
Genome map
AA seq 416 aa AA seqDB search
MLITVPLAGELKFYPLNETFRITFGAPTFFFFLLLLKRKTVLSGGLLTALSVVLFRIMLD
YITLDHFQFAASAHTHYPTFFFYFTYALLFFIFKVSRMNYSAIVIGLIGLIIEIAADIVE
LTAQYIVLHTTIHIDSLSDMAVIAFAHSFIVLSFFNMMTIYESQSRERQIRKQNEHMLML
ITSLYEETVHLKKTLHNTEVITKASYDLYRVLNQQEKDHSMLNQTLSKKALRIAGDIHEV
KKDNQRIFAGLSKTISNESFQNYMKAEELIELIVRINKKYADSLHKQITFFSSVNGEHFS
YHVYTILSIINNLVANAVEAIKDEGRIVLSVHRQAEHVEFHVQDNGPGVPLKYEKAIFEP
GFTSKYDQFGNPSTGIGLSYVKDIVQELEGTIKATQEDSGMTFIIQIPLRNLIQKG
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgctcattactgttccgctggcgggagagctaaaattttatccgttaaatgaaacattt
cgaattacatttggagctccaacatttttctttttcctattgcttttaaaacggaaaacc
gttttatctggcggcttgttaaccgctttaagcgtcgttctctttcgcatcatgctcgat
tatatcacgctcgatcattttcaatttgcggcttctgcacatacgcattaccctacgttt
ttcttttactttacgtatgcacttttattttttatttttaaagtaagccgcatgaactat
agtgctattgtgattggattaattggactcatcattgaaatagctgctgatatagtcgaa
ctaactgcgcagtatatcgttttgcacacaaccattcatatcgattcattatccgacatg
gccgttattgcttttgctcacagctttattgtacttagcttttttaatatgatgacaatt
tatgaatcacagtcacgagaacgtcaaattcgcaaacaaaatgagcacatgctaatgctt
attacaagcctttatgaagaaaccgttcatttaaaaaagacccttcataatacagaagtg
attacaaaagcctcgtacgatttataccgtgtattaaatcagcaagaaaaagatcattct
atgctaaaccaaacgctcagtaaaaaagcgcttcggattgccggagatattcacgaagta
aaaaaagacaaccagcgtatttttgcgggcttatctaaaacaatttcaaatgaaagtttc
caaaattatatgaaagcagaggaattaatcgagctaatcgtacgcattaacaaaaaatat
gccgattcccttcacaaacaaattacctttttttcctctgtaaacggggaacatttcagc
taccacgtttataccattttatcgatcattaataacttggtagcaaacgcagtggaagcg
attaaagatgaaggaaggattgttttatcggtacatagacaagctgaacatgtagaattc
catgtacaagacaacggtcctggcgtgcctttgaagtacgaaaaagctatttttgaacct
ggtttcacctcaaaatacgatcaatttggaaacccctctactggcattggcctttcttat
gtaaaagatattgttcaagagcttgaaggtacgattaaagctacacaagaagacagcgga
atgacgtttatcattcaaatcccccttcgtaatctaattcagaaaggatga

DBGET integrated database retrieval system