KEGG   Bacillus megaterium WSH-002: BMWSH_4447Help
Entry
BMWSH_4447        CDS       T01890                                 

Gene name
ycbB
Definition
(GenBank) CheY-like,Response regulator receiver
  KO
K07719  two-component system, response regulator YcbB
Organism
bmh  Bacillus megaterium WSH-002
Pathway
bmh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BMWSH_4447 (ycbB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bmh02022]
    BMWSH_4447 (ycbB)
Two-component system [BR:bmh02022]
 Other families
  GlnK-GlnL (glutamine utilization)
   BMWSH_4447 (ycbB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YcbB Response_reg
Motif
Other DBs
NCBI-ProteinID: AEN91325
LinkDB All DBs
Position
4198348..4199286
Genome map
AA seq 312 aa AA seqDB search
MRFCITDDDSAIRSTLSQLIEDEDLGEVVEEVVDGSFLDASMLNLKQIDILFIDLLMPGR
DGIETIRHLKDSFNGKMIMISQVESKELIGEAYSLGIEYYITKPINRIEILTVIRKVMER
ISLEKSIDDIKTSLNSLATAHHAPPSSQPITKQVHLYDVGKFLLAELGIVGENGAKDLLD
ILQFLYTYDQRESVEKHFPSLKNIFVNIAEKKLGAHASSIEINRETKACEQRIRRAVTHS
LNHFASIGLTDFSNPKFENYASKFFDFTAVRKKMKELQGDSKILPIRINTKKFIQIFFFE
AKRLLSKEKSWY
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcgattttgtattacagatgacgattcagctattcgttcaacgctcagtcagctgatt
gaagatgaggatttaggagaagttgtagaagaagtcgtcgacggaagctttttagatgct
tctatgttaaatttaaaacaaattgatattttatttatcgatttacttatgccaggacgg
gatgggatcgaaacgatccgtcatttaaaagattcatttaacggaaaaatgattatgatt
tcacaggtagagtccaaagaattgataggagaagcctattcattaggaattgaatactat
attacaaaaccaattaatcgaattgaaattttaacggttattcgaaaagtaatggaacga
atctcccttgagaaatcaatcgatgatattaaaacctccttgaacagtttagcgacagct
catcacgctcccccttcaagccagccgataacgaaacaagtccatctatacgatgtagga
aaattcttattagccgagttaggtattgtaggagaaaatggtgcaaaagatttactggat
attttacagtttctgtacacttatgaccaaagagaaagtgtggaaaaacatttcccttct
ctaaaaaatatttttgtgaatattgctgagaaaaaattgggagctcacgcgtcttccatt
gaaattaatcgtgaaaccaaagcttgtgaacagcgaataagacgagcagttactcactca
ctaaatcactttgcttctattggattaacagatttttcaaatccaaagtttgaaaattat
gcttctaagttttttgactttacagccgttcgtaaaaaaatgaaagaattgcagggagat
tctaaaattttgccgattcgcattaacaccaaaaagttcattcaaatattcttttttgaa
gcaaagcgcttgttaagcaaggagaaaagctggtattga

DBGET integrated database retrieval system