KEGG   Bacillus megaterium WSH-002: BMWSH_4464Help
Entry
BMWSH_4464        CDS       T01890                                 

Definition
(GenBank) Isocitrate lyase and phosphorylmutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
bmh00440  Phosphonate and phosphinate metabolism
bmh01100  Metabolic pathways
bmh01120  Microbial metabolism in diverse environments
bmh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bmh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BMWSH_4464
Enzymes [BR:bmh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BMWSH_4464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transferase Cucumopine_C
Motif
Other DBs
NCBI-ProteinID: AEN91342
LinkDB All DBs
Position
complement(4216218..4217735)
Genome map
AA seq 505 aa AA seqDB search
MKKTKQLRELIESKQLEFIMEAHSALSAKIVEEAGFKGIWASGLSLSAALGVRDNNEASW
TQVLDILEFMSDATSVPILLDGDTGYGNFNNARRLVKKLEQRDIPGVCIEDKLFPKTNSF
IKGEAQPLADINEFCGKIKAMKDSQNDEDFVVVSRVEAFIAGWGLKEALKRAEAYRQAGT
DAVLIHSKRSDMTEIEAFMKEWGNRLPVIIVPTKYYSVPTDKFSDLGISLSIWANHNLRS
SITAMQKTSAQIYYDKSLINVEKNVSPLEEVFRLQKAEELDMAEKLYLSSANHSINAMIL
VKKSANDVLITEQMNQLKKVGVTNSIKVDSNKAMEDKESPNQGELYDLYAARDKLGTATL
ISDSNIVYKTHVFEELIHESGDITIVAGADYDLKGDQTSYVTAEFPYSKKLYSKTVDLIQ
MSSSPNSKNIHGEFIGLWKVSGKGTEVVKKVLEELAQREDFAQLTFSDFFNYINLIHPVA
VKYTMGSWIDTETYIKLQKDGGKND
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaccaaacagctaagagagttgatagaaagcaagcagctagagtttattatg
gaggctcacagtgcgctatctgcaaagattgtagaagaagcagggttcaaagggatatgg
gccagcggcctgtctttatccgcagcactgggtgtaagagataataatgaggcttcgtgg
acacaggtattagatatcttagagtttatgagtgatgcaacgtccgttcccattcttctg
gatggtgatacaggctatgggaattttaataatgcaagaagattagttaagaagttggag
cagcgagacattccaggcgtatgtattgaagataaattgtttccaaaaacaaactcattt
attaaaggtgaagcacagccgctcgcagatattaatgaattttgcggcaaaattaaagca
atgaaagatagccaaaatgacgaagattttgtagtggtatcgcgtgtagaagcatttatt
gcagggtgggggctgaaagaagctttaaaacgtgcagaagcttatcgccaagcgggaacc
gatgccgttttgattcatagtaaaaggtcagatatgacagagattgaagcttttatgaaa
gagtggggaaacaggcttccggttattattgttccaaccaaatattattcggttccaact
gataaatttagtgatttaggaattagcttaagcatttgggccaaccataatttaagatct
tctattacagctatgcagaaaacgtccgctcagatttattacgataaaagtttgattaac
gtagaaaaaaatgtctctccgcttgaggaagttttccgtcttcaaaaagctgaagagctc
gatatggcagagaaactttatttaagctctgccaatcatagtattaacgctatgattctg
gtaaaaaaatcagcaaatgacgttttaataactgagcaaatgaatcaattaaaaaaagtt
ggcgtgacaaatagtataaaagtagacagtaacaaagctatggaagacaaggagtctcct
aatcaaggagaattatatgatctttatgctgcaagagataagctaggaacggctacttta
atcagtgatagtaacatcgtgtataaaactcatgtttttgaggagttaattcatgaaagt
ggtgatatcactatcgtagcaggagctgattatgatttaaaaggggatcaaacatcttat
gtaacggctgaatttccctattccaaaaagctttattccaaaacagtagacttaattcaa
atgtcatccagtccaaattctaaaaacattcatggtgaattcattggtctttggaaagtt
tccggaaaaggcactgaggttgtaaaaaaagttttggaagaactggcacaaagagaagat
tttgctcagctcacgttctctgatttttttaattatattaatttaattcatccggttgct
gttaaatatacgatgggatcatggatagataccgaaacgtatataaagcttcaaaaagat
ggtgggaaaaatgattag

DBGET integrated database retrieval system