KEGG   Bacillus megaterium WSH-002: BMWSH_4472Help
Entry
BMWSH_4472        CDS       T01890                                 

Gene name
nasD
Definition
(GenBank) Assimilatory nitrate reductase (Electron transfer subunit)
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
bmh00910  Nitrogen metabolism
bmh01100  Metabolic pathways
bmh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmh00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BMWSH_4472 (nasD)
Enzymes [BR:bmh01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     BMWSH_4472 (nasD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Fer2_BFD Rubredoxin_C Pyr_redox Pyr_redox_3 NIR_SIR_ferr NIR_SIR GIDA HI0933_like NAD_binding_7 AlaDh_PNT_C 3HCDH_N GMC_oxred_N K_oxygenase TRI5
Motif
Other DBs
NCBI-ProteinID: AEN91350
LinkDB All DBs
Position
complement(4227349..4229694)
Genome map
AA seq 781 aa AA seqDB search
MTKQKLILIGNGMAGMRCIEEILIHSPGCFDITVFGSEPHVNYNRILLSTVLQGSTKLED
INIHSFAWYKENNITLCKGESVTHIDTERKIIKTDKNRETRYDKLIIATGSSPYMLPVKG
SDKEGVLGFRTIEDCRKMIEISKQYKKAAVIGGGLLGLEAARGLLNLGMDVQVIHHSGFL
MERQLDRAASAMLREELEKQGMSFLLNKHTDEIIGNNRAEGVRFNDSSKIAADLVVMATG
VRPNVNLAKKSGIKTNRAIIVNDYLETSIPDIYAVGECAEHRGMTYGLVAPLYEQGKVLA
RHLCQIKNDGYRGSVLSTQLKISGIDVYSVGEFKENQGAKAITISNMLDGIYKKVVFREE
KIVGAVLFGDTSEAIKLSQMINEKKDLSQAEKVQLFPSQHEKENAVTSMPLTDIVCNCNS
VTKGAIIEAVQKNDLTTVDEIKNCTKASGSCGGCKPLVTDLLTYIQSDEFDEIIEQKTFC
TCTHLSEDELVREMQQYQFETVQQVREILKFKDMKGCSLCEGGLHYYLDMMNPHYKNNRH
SLFTTENDQAVLLHDGTYAVVPQIHGGLTNVQELRNIANVAERYNISNIRLTSDQRIQLI
GVKKEYLPLISEEVDRGLQQLYERTVKNVSVYIGKGTCICQYEPALALSNELDKQLEYVK
TPCDIKISIASCSHIAESVTTSDIGLRRIERGWEIYAGGSSAEARSGELFYVAETNEEAV
EISCSLIQYYRETGNYLETVGSWIERVGIVHVREVLFEVDNREYLMKQLSSERSRAITYL
L
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaacaaaagctgatattaatcggaaatggaatggcgggaatgcgctgtattgaa
gaaattcttattcattctccaggttgttttgatattactgtttttggaagtgagcctcac
gttaactataatcgaattttattatcaaccgttttacaaggtagtacaaagcttgaagat
ataaatattcattcttttgcatggtataaggaaaataatatcactttatgtaaaggagaa
agcgttacgcacatagacaccgagagaaaaataataaaaacagataaaaacagagagacg
aggtacgacaagcttattattgctactggttcgagcccgtatatgctccccgttaaaggg
tctgacaaagaaggtgtcctcggttttcgtaccatcgaagactgccgaaaaatgattgaa
atttctaaacagtataaaaaagcagcggttattggaggaggtctgttagggctggaagcc
gctagaggactattaaatttgggaatggatgttcaagtgattcatcattcgggtttctta
atggagcgacagttagacagagcagcatctgctatgttaagagaagaattagaaaagcaa
ggcatgagttttctgttaaacaaacatacagatgagattatagggaacaaccgagcagaa
ggcgtccgatttaacgatagcagtaaaattgcagctgatttagttgtaatggctacagga
gtgagaccaaatgttaatctagctaaaaaaagcggaataaaaacaaatagagcaattatc
gtaaatgattatttagaaacgagcatcccggatatctatgcagtaggtgaatgtgctgaa
catcgagggatgacatacggccttgttgctcctctttacgaacaaggaaaagtcttagca
cgacacctttgccaaataaaaaacgatggttatcgcgggtccgttctttccactcaatta
aaaatatcaggaatagacgtttactcagtcggagagttcaaggaaaatcaaggtgcaaaa
gccattacgatttcgaatatgttagatggtatatacaaaaaagtagtttttcgcgaagag
aaaatagtgggagctgttctttttggagataccagtgaggctataaagctgtcacaaatg
attaatgaaaaaaaggatttgtcgcaagcggaaaaagtacaactatttccttctcaacat
gaaaaagaaaatgcagtaacttctatgccacttacagatatcgtatgcaactgtaacagt
gtaacaaagggagccattattgaagcagtacagaaaaatgatttaacgacagtagatgaa
ataaaaaattgcacgaaagcttctggttcatgcggaggatgcaaaccccttgtaacagat
cttttaacatatattcaaagcgatgagtttgatgaaatcattgaacaaaaaaccttttgt
acatgtacacatttatcagaagatgagctggtaagagaaatgcagcaatatcaatttgaa
acggttcagcaagtaagagaaatattaaagtttaaagacatgaaaggctgttcgttatgt
gaaggcggtcttcattactatttagatatgatgaatcctcattataaaaacaatcgacat
tctttatttactacggagaatgaccaggcagttttgcttcacgatgggacttatgcagtg
gtaccgcaaattcatggtggtctgacaaatgtacaggaattaaggaacatagcaaatgta
gctgaaaggtacaacatctctaatattcgtttaacaagtgatcagcgcattcaacttatt
ggagtgaaaaaagaatatcttccgttgataagtgaggaagtagatagaggacttcagcag
ctatatgaacgtacagttaaaaatgtatctgtttatataggaaaaggaacgtgtatttgt
cagtatgaacctgctcttgctttatcaaatgaattggataaacagcttgaatatgtaaag
accccatgtgatatcaaaatcagtattgcttcgtgttctcacattgcagagagtgtaaca
acaagtgatataggattaagaagaatagaaagaggatgggaaatatatgctggcggaagc
agcgcagaagccagaagcggggagctgttttatgtggccgaaacaaacgaagaagcagta
gaaatcagctgttctttgattcaatattaccgtgaaacggggaactatttagaaactgtc
gggagctggatcgaacgagtaggaattgttcatgtcagagaagttttgtttgaggtagac
aatcgagagtatttaatgaagcagctcagctcagaacgctctcgtgcaatcacatattta
ttatag

DBGET integrated database retrieval system