KEGG   Bacillus megaterium WSH-002: BMWSH_5006Help
Entry
BMWSH_5006        CDS       T01890                                 

Gene name
alr
Definition
(GenBank) Alanine racemase 1
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
bmh00473  D-Alanine metabolism
bmh01100  Metabolic pathways
bmh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bmh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BMWSH_5006 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BMWSH_5006 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bmh01011]
    BMWSH_5006 (alr)
Enzymes [BR:bmh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BMWSH_5006 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bmh01011]
 Precursor biosynthesis
  Racemase
   BMWSH_5006 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AEN91884
LinkDB All DBs
Position
complement(4794596..4795786)
Genome map
AA seq 396 aa AA seqDB search
MVLKKGSVVVMDAFYRETWAEIDVEAIFQNVNHVRELIPGHKMLMAVVKANAYGHGDKEV
AEIALQAGADMLAVAFLDEAIALRKKGIKESILVLGAVPTLHIQTALEWDVTVTAYSKAW
IEEAASILGENSQLHMHLKIDTGMGRLGIRTKEELHKTMKIIASHSGFVLDGVFTHFATA
DELNSSYFEEQYTFFEEMVGIVKEHNFTPPMIHCANSAALLRRPNDIFNGVRLGISMYGL
SPSEELKEVLPIPLKQAFSLHSRIVHVKKVKKGSHISYGATYEAKEDEWIATIPVGYADG
WIRKLSNFEVLVDGVKVPIVGRICMDQLMIKLPKMYKTGTKVTFIGKQKGAEITIDEVAK
HLETINYEIPCMVAARVPRVYTRDSQHIDVNNYILR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggttctgaaaaaaggaagtgtcgtagtaatggatgcattttatagagaaacatgggca
gaaattgatgtagaagccatttttcaaaatgtgaatcatgtaagagaactgataccgggg
cataaaatgttaatggccgtagtaaaagcgaatgcgtacgggcatggagataaagaagta
gcagagattgcgcttcaagctggcgctgatatgctagctgtagcttttctggatgaagct
attgctcttcgaaaaaaaggaataaaggaatccattttagtattaggagccgtgcctacc
ctacacattcaaaccgcattggagtgggatgtaacggtcactgcttatagcaaagcttgg
attgaagaagcagcgtccattctaggtgaaaacagtcagctgcatatgcacttaaaaata
gatacaggcatgggtcgcttaggaattagaacaaaagaagaattacacaaaacgatgaag
atcatcgcttctcattcgggatttgtgctggatggagtgtttacacactttgcaacagca
gacgagctaaattcgtcttattttgaagaacaatacacattctttgaagaaatggttgga
attgtgaaagaacataattttacacctccgatgattcactgtgcaaatagcgcagccttg
cttcgtcgtccgaacgatatctttaatggcgtacgcttaggtatctctatgtatggcttg
agcccttctgaggaattaaaagaagttttgccaattccgttaaaacaagctttttcgctg
cacagccgtattgtgcatgttaaaaaagtcaaaaaagggagtcatatcagttacggagct
acttatgaagctaaagaagatgaatggattgctactattccagtaggatatgcagacggc
tggattcgtaaattaagtaattttgaagtgttagtagatggagttaaagtgccaattgtt
ggtagaatatgcatggatcaattgatgattaaattgcctaaaatgtataaaacgggcacg
aaagtcacatttattggaaaacaaaaaggtgctgaaattacaattgatgaagtagcgaag
catcttgaaacaattaattatgaaatcccttgcatggttgcagcaagggttccgagggtt
tatacaagagattcgcagcatattgatgttaataattatatcttgcgctga

DBGET integrated database retrieval system