KEGG   Bacillus megaterium WSH-002: BMWSH_5138Help
Entry
BMWSH_5138        CDS       T01890                                 

Gene name
hslO
Definition
(GenBank) Hsp33-like chaperonin
  KO
K04083  molecular chaperone Hsp33
Organism
bmh  Bacillus megaterium WSH-002
Brite
KEGG Orthology (KO) [BR:bmh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bmh03110]
    BMWSH_5138 (hslO)
Chaperones and folding catalysts [BR:bmh03110]
 Heat shock proteins
  HSP33
   BMWSH_5138 (hslO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33 DUF3222 Peptidase_M3_N SurA_N_2 Elf1
Motif
Other DBs
NCBI-ProteinID: AEN92016
LinkDB All DBs
Position
complement(4927504..4928382)
Genome map
AA seq 292 aa AA seqDB search
MGDYLVKALAYNSQVRAYAVKTTDTVGEAQRRHYTWPTASAALGRSMTAGVMMGAMLKGE
QKLTIKIEGRGPIGVILVDSNAKGEVRGYVTNPQTHFDLNQHGKLDVARAVGTDGTLSVV
KDIGMRDQFNGQVPIVSGELGEDFTYYFVTSEQVPSSVGVGVLVNPDNTILAAGGFIIQL
LPGTDDKTITAIEQRLQTIEPISKLIQKGLSPEEILEEVLGKENVKFLETMPVEFKCQCS
EERIANAIISLGQEEIQSMIEEDGQAEAQCHFCNETYRFDKKQLEEMKEQAI
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgggcgactatttagtaaaagcactagcttacaatagtcaagttcgcgcttatgcggta
aaaacaacggatacagttggagaagcgcagcgccgtcactatacatggcctacagcctct
gcagcattgggacgttcaatgactgcgggagttatgatgggggctatgctaaaaggtgag
caaaagctaacaattaaaattgaaggccgcggcccaattggcgttatcttagtagacagc
aatgctaaaggggaagtgcgtggatatgtaacgaatccacaaacgcacttcgatttaaat
cagcatgggaaattagatgtagcacgtgctgtaggtacagatggcacgctaagtgtcgta
aaagacatcgggatgcgtgatcaatttaatggacaagtacctatcgtatccggagaatta
ggagaggatttcacgtattattttgtgacatctgaacaagtcccatcttcagtaggtgta
ggagtacttgttaaccctgataacacgatcttagctgcgggcggatttatcattcagctt
ctgccgggaacagatgataaaacgattacagctattgaacaacgattacaaacgattgag
cccatttcaaaactgattcaaaaaggtctttctcctgaggaaatcttagaagaagttctt
ggaaaagaaaatgtaaagtttctggagacaatgcctgtagagttcaaatgtcagtgctca
gaagaaagaattgccaatgctattatcagcttaggacaagaagagattcaatcaatgatt
gaggaagatggccaagctgaagcacagtgtcatttctgtaatgagacctatcgttttgat
aaaaaacagcttgaagaaatgaaagaacaagcaatttaa

DBGET integrated database retrieval system