KEGG   Brucella melitensis ATCC 23457: BMEA_A1117Help
Entry
BMEA_A1117        CDS       T00867                                 

Definition
(GenBank) Phosphoribosyl-AMP cyclohydrolase
  KO
K01496  phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
bmi  Brucella melitensis ATCC 23457
Pathway
bmi00340  Histidine metabolism
bmi01100  Metabolic pathways
bmi01110  Biosynthesis of secondary metabolites
bmi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bmi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BMEA_A1117
Enzymes [BR:bmi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     BMEA_A1117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH
Motif
Other DBs
NCBI-ProteinID: ACO00856
UniProt: C0RJ48
LinkDB All DBs
Position
I:1065024..1065443
Genome map
AA seq 139 aa AA seqDB search
MSIFPAQPSDKKAVEEGAAFMPRFDASGLITAIVTDARDGELLMVAHMNEEALRLTLETG
IAHYWSRSRKTLWKKGETSGNLQSVVELRTDCDQDALWLKVHVAGDGPTCHTGRRSCFYR
QVVSSGGKVALTMASDHDQ
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttttcctgcccagccttccgacaagaaggccgttgaagaaggcgcggcattc
atgccgcgctttgatgcatccggcctcattacagcgatcgtcactgatgcgcgcgatggc
gaattgctgatggtcgcgcatatgaacgaggaagccctgcgccttacactggaaaccggc
attgcccattattggtcgcgctcgcgcaagacgctatggaaaaagggcgaaacctccggc
aacctgcaaagcgtggtcgaattgcgcacggattgcgatcaggatgcactctggctgaaa
gtgcacgtcgccggtgacggcccgacatgccatacggggcgtcgttcgtgcttctatcgt
caggtcgtttcgtcgggtggcaaggtggcgctgacaatggcaagcgatcacgatcaataa

DBGET integrated database retrieval system