KEGG   Brucella melitensis ATCC 23457: BMEA_A1547Help
Entry
BMEA_A1547        CDS       T00867                                 

Definition
(GenBank) Aspartate aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
bmi  Brucella melitensis ATCC 23457
Pathway
bmi00220  Arginine biosynthesis
bmi00250  Alanine, aspartate and glutamate metabolism
bmi00270  Cysteine and methionine metabolism
bmi00330  Arginine and proline metabolism
bmi00350  Tyrosine metabolism
bmi00360  Phenylalanine metabolism
bmi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bmi00401  Novobiocin biosynthesis
bmi01100  Metabolic pathways
bmi01110  Biosynthesis of secondary metabolites
bmi01130  Biosynthesis of antibiotics
bmi01210  2-Oxocarboxylic acid metabolism
bmi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bmi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BMEA_A1547
   00270 Cysteine and methionine metabolism
    BMEA_A1547
   00220 Arginine biosynthesis
    BMEA_A1547
   00330 Arginine and proline metabolism
    BMEA_A1547
   00350 Tyrosine metabolism
    BMEA_A1547
   00360 Phenylalanine metabolism
    BMEA_A1547
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BMEA_A1547
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    BMEA_A1547
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bmi01007]
    BMEA_A1547
Enzymes [BR:bmi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     BMEA_A1547
Amino acid related enzymes [BR:bmi01007]
 Aminotransferase (transaminase)
  Class I
   BMEA_A1547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ACO01254
UniProt: C0RED2
LinkDB All DBs
Position
I:1471977..1473179
Genome map
AA seq 400 aa AA seqDB search
MAFLADALSRVKPSATIAVSQKARELKAKGKDVIVLGAGEPDFDTPENIKQAAIAAINRG
ETKYTPVSGIPQLRQAIVSKFKRENGLDYKPEQTIVGTGGKQILFNAFMATLNPGDEVII
AAPYWVSYPEMVAINGGTPVFVDTKIEDNFKLTAADLEKAITPKTKWLIFNSPSNPTGAA
YTQAELKSLTDVLVRHPHVWILTDDMYEHLVYGDFVFTTPAQVEPSLYDRTLTMNGVSKA
YAMTGWRIGYAAGPIELIKAMDMIQGQQTSGACSIAQWAAVEALNGTQDFIPANKKIFQA
RRDLVVSMLNQATGLQCPTPEGAFYVYPSCAGLIGKKTEAGKVIETDKDFVTELLETEGV
AVVHGSAFGLGPNFRISYATSDELLEKACIRIQRFCASLR
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcatttctcgccgacgccctttcccgtgtaaagccatctgcgaccatcgctgtcagc
cagaaagcacgtgaactgaaagcaaaaggcaaggacgtgatcgtcctgggcgcaggtgag
ccggatttcgacacgcctgaaaatatcaagcaggcggccattgccgcgatcaatcgcggt
gaaacaaagtacacgcccgtatccggcatcccgcaactgcgccaggccatcgtctccaag
ttcaagcgtgaaaacggcctcgactacaagccggaacaaaccatcgtcggcaccggcggc
aagcagattttgttcaacgccttcatggccacgctgaaccccggcgacgaagtcatcatt
gccgccccctattgggtcagctacccggaaatggtggccatcaacggcggcaccccggtt
ttcgtcgacacgaagattgaagacaatttcaagctgaccgctgccgatctcgaaaaggcg
atcacaccgaagaccaagtggctcatcttcaactcgccctccaacccgaccggcgcggcc
tatacgcaagccgaactgaagtcgctgaccgacgttctcgtgcgccatccgcatgtctgg
atcttgaccgacgacatgtatgagcatctggtctatggcgatttcgtcttcacgacgcct
gctcaggtggaaccctcgctctatgaccgtacgctcaccatgaacggcgtttccaaggcc
tatgccatgaccggctggcgcatcggctatgccgccggtccaatcgagctcatcaaggcc
atggacatgattcaggggcagcagacctccggcgcctgctcgattgctcagtgggcagcg
gtcgaagcactgaacggcacgcaggatttcatccccgcgaacaagaaaatcttccaggcc
cgccgcgatctggtcgtttccatgctcaaccaggcaaccggcctccagtgcccgacgccg
gaaggcgcgttctatgtctatccgtcctgcgcagggctgatcggcaagaagaccgaagcg
ggcaaagtcatcgaaaccgacaaagattttgtgacggaacttctggaaaccgaaggcgtg
gcggttgttcatggttcggcattcggcctcggcccgaacttccgcatttcctatgcaacc
tcggatgagctgctggaaaaagcctgcatacgcatccagcgtttctgcgccagcctgcgc
tga

DBGET integrated database retrieval system