KEGG   Brucella melitensis ATCC 23457: BMEA_A2154
Entry
BMEA_A2154        CDS       T00867                                 

Definition
(GenBank) Sensor protein chvG
  KO
K14980  two-component system, OmpR family, sensor histidine kinase ChvG [EC:2.7.13.3]
Organism
bmi  Brucella melitensis ATCC 23457
Pathway
bmi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BMEA_A2154
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bmi01001]
    BMEA_A2154
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bmi02022]
    BMEA_A2154
Enzymes [BR:bmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BMEA_A2154
Protein kinases [BR:bmi01001]
 Histidine kinases
  OmpR family
   BMEA_A2154
Two-component system [BR:bmi02022]
 OmpR family
  ChvG-ChvI (acidity sensing)
   BMEA_A2154
SSDB
Motif
Pfam: Stimulus_sens_1 Sensor_TM1 HATPase_c HisKA HAMP DUF3454 HATPase_c_2 HATPase_c_3 dCache_1 Baculo_PEP_C
Other DBs
NCBI-ProteinID: ACO01800
UniProt: C0RFX8
LinkDB
Position
I:2031789..2033594
AA seq 601 aa
MVAETQKDSLSGMRERRARRQRSVFLRRFLSPLRKFLGQYLFSSLTRRILFLNLAALAVL
VSGILYMNQFREGLIDAKIESLLTQGKIIAAAISASVTVDTNSLLIDPEKLLELQAGQSI
TPSPDSPDNWEFPINPEKVSPLLRQLISPTSTRARIYDRYANKLLDSRALYSTSFPSSGP
VLRYDLPPIEDETPALWERIGSWLSRLFYGGGLPLYQEQPGGNGLAYQEIVKALSGSPQM
AQRRNQRGELIVSVAVPIQRSRAILGVLLLSTEGDDIDKIVQAERMAVFRVFGVVSAVMV
ILSLFLASTIANPLRKLSAAADRVRHGVKNRVEIPDFSERQDEVGHLSTSIRDMTDALYT
RIEAIESFAADVSHELKNPLTSLRSAVETLPLAKTDESRKRLLDVIQHDVRRLDRLITDI
SDASRLDAELAREHIDRVDMKKLLTSLVTAAREVRRNKVGTEIVFNTGKLPTGKKGFYVA
GHDLRLGQVVSNLIENARSFVPDDTGRIVVTLAGEGNRLRILVEDNGPGIPIENIERIFE
RFYTDRPASEAFGQNSGLGLSISRQIIEAHGGTLTAENITDPDKPDIFKGARFIVDLPAS
A
NT seq 1806 nt   +upstreamnt  +downstreamnt
atggtcgcagagacccagaaagatagcctttcggggatgcgcgagcgcagagcacggcgg
caacgctcggtgtttctgcgccgctttctgtcgcccttgcgcaagtttcttgggcaatat
ctcttttcaagcctgacgcgccgcatcctgtttctcaacctggcagcactggccgttctg
gtttccggcattctttatatgaaccagttccgcgaggggctgatcgacgccaagatcgaa
agcctgctgacgcagggcaagatcatcgctgctgcgatttctgcatcggttacggtcgat
accaattcgctgctgatcgaccctgaaaagcttctggagcttcaggccgggcagagcata
accccctcccccgattcgccggataattgggaatttccgatcaatcccgaaaaggtttcg
ccgctgctgcgccagttgatctctccgaccagcacgcgcgcgcgcatctatgaccgctat
gcgaataagctgcttgattcgcgcgcgctttattcgacaagcttcccgtccagcgggccg
gtcctgcgctatgacctgccgccgatagaggatgagacgcctgccctttgggaacgtatc
ggcagctggctgtcgcgccttttctatggcggtggcctgccgctctaccaggagcagccg
ggcggaaacggccttgcctatcaggaaatcgtcaaggcgctgagcggctcgccgcagatg
gcacagcgccgcaatcagcgcggtgagctgatcgtttccgtggccgttcctatccagcgc
tcccgtgccattctgggtgttctgcttctttctaccgaaggcgatgatatcgacaagatc
gttcaggccgagcgtatggcggttttccgcgtgttcggcgttgtgtcggcggtcatggtc
atcctgtcgcttttcctcgcctcaacaattgccaaccccttgcgcaagctttcggctgcg
gcggaccgggtgcgccatggcgtgaaaaaccgcgtggaaattcccgatttttccgagcgt
caggacgaggtgggccacctttccacctccatccgcgacatgacggacgcgctttatacg
cgcatcgaagccattgaaagcttcgcagccgatgtcagccatgagctgaagaaccccctc
acctcgcttcgcagcgcagtcgaaaccctgccgctcgccaagaccgacgaatcacgcaag
cgcctgctcgatgtcatccagcacgacgtgcggcggctggaccgccttatcacggatatt
tccgacgcttcgcgcctcgatgccgagcttgcgcgcgaacatatcgaccgcgtggatatg
aaaaagcttctcaccagccttgtgactgccgcccgcgaagtgcggcgcaacaaggtcggc
accgaaatcgtgttcaacacgggcaagctgcccaccggcaagaaaggcttctatgtcgcc
ggccacgatctgcgtcttgggcaggtggtaagcaaccttatcgagaatgcgcgctccttc
gtgcctgacgatacgggccgtatcgtcgttacgctggccggcgaaggcaaccggctgcgc
attctggtcgaggataacggccccggcattcctatcgagaatatcgagcgcatcttcgag
cgtttctacacggatcgcccggcatcggaagcattcgggcagaattccggcctcggcctg
tcgatcagccggcagatcatcgaggcgcatggcggcacgctgacggcggaaaatattacc
gatccggataagccggatattttcaagggtgcccgctttatcgttgatcttccggccagc
gcatga

DBGET integrated database retrieval system