KEGG   Babesia microti: BmR1_04g07650Help
Entry
BmR1_04g07650     CDS       T05554                                 

Definition
(RefSeq) succinate dehydrogenase (ubiquinone) flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
bmic  Babesia microti
Pathway
bmic00020  Citrate cycle (TCA cycle)
bmic00190  Oxidative phosphorylation
bmic01100  Metabolic pathways
bmic01110  Biosynthesis of secondary metabolites
bmic01130  Biosynthesis of antibiotics
bmic01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BmR1_04g07650
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BmR1_04g07650
Enzymes [BR:bmic01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BmR1_04g07650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 FAD_binding_3 GIDA
Motif
Other DBs
NCBI-GeneID: 24426170
NCBI-ProteinID: XP_021337195
LinkDB All DBs
Position
IV
AA seq 625 aa AA seqDB search
MIVSNRALKFSFHLKISGRHFSKTAYKIIDHKFDALVIGAGGAGLRASLELSSLGYKTAC
VSKVFPTRSHTVAAQGGINAALGNISKDDWRWHAYDTVKGSDWLGDQDAIQYMCREAPQT
VIELERYGLPFSRTPDGHIYQRAFGGQSLEFGKGGQAYRCAAAADRTGHAMLHTLYGQSL
SYDCKFFVEYFLLDLLMDNSDVPRCIGAICLDISSGTIHRFLSNSTIICTGGYGRCYKSC
TSAHICTGDGNAAVSRVGLPLQDLEFVQFHPTGIFPAGCLITEGCRGEGGILRNSEGEGF
MAQYAPTAKDLASRDVVSRAITVEINEGRGCGENKDHIHLDLTHLSPETIKERLPGISET
AKIFAGVDVTIQYIPVLPTVHYNMGGIPTNWKAQVLTKVGQNEVIVQGLYAAGECASASV
HGANRLGANSLLDICVFGKRAALTIKEMVKPGEKLPPLPPDSTEQTIQRFDSIRFSNSHD
GIPTSQIRDKMQDAMQLHVSVFRTGESLKKGVEKIESICREFKNVRISDSSLIWNTDLLE
TLELENLLMLSYQTVVSALAREESRGAHSRDDFPERDDQMWRKHTLSWAKHRNVESTKIE
LDYRPVVDKTLDSEMDTIPPTKRKY
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgatagtttctaatagagcattaaaattttctttccatttaaagatatcgggacgtcat
ttttctaagactgcatataaaataattgaccacaaatttgatgcccttgttattggagct
ggaggagctggacttagagcgtcattagaactgtcttctttgggttacaaaacagcatgc
gtatcaaaagtatttcctacaagatcacataccgttgcggcacagggcggaataaatgct
gctctaggaaatatttcaaaagatgattggagatggcatgcgtatgatacggttaaaggt
tcggattggcttggagatcaggacgccatacaatatatgtgtagagaagctccacaaacc
gtaatagaattagaaagatatggacttccattttcaaggacaccagatggacatatatat
caacgagcatttggcggccaaagcttggaatttgggaaaggtggacaggcatatagatgt
gcagcagcagcggatagaactggccatgcaatgctgcacacattatatggccaatcacta
tcatatgattgcaaattttttgtagaatatttcttattagatttactaatggacaattcc
gatgtacctagatgcattggtgcaatatgcctggatatatcatccggtactattcatcgt
ttcttatctaatagtacgattatctgcaccggtggttatggaagatgttataaatcttgt
acatcagcacatatttgcactggagatggaaatgctgcggtttccagagtcgggttacca
ttacaagatctcgaatttgttcaattccatcccactggtatcttccccgctggatgttta
attaccgaaggttgcagaggtgaaggtggtatattgaggaattctgagggagaagggttt
atggctcaatatgcacccactgctaaagatttagctagtagagatgttgttagtagggcg
attactgttgaaataaatgaaggccgtggatgcggtgaaaacaaagatcatatacattta
gatctaactcatttatcaccagaaactattaaggaaagattgcctggaatatctgaaacg
gcaaagatttttgctggggtagatgtcacaattcaatatataccagtattgccaactgta
cattataatatgggtggcattcctaccaattggaaagctcaagttttaactaaagttggc
caaaatgaggtcatagtccagggactgtatgctgctggtgaatgtgccagcgcaagtgtt
catggtgccaataggcttggagcaaattcacttttggatatttgtgtttttggcaagcgc
gccgctttgactattaaggaaatggttaaacctggagagaaactaccaccgctccctcct
gattctactgaacaaacgatacaaaggtttgattccattagattttctaatagtcatgat
ggaatccctacatctcaaatcagagataaaatgcaagatgctatgcagttacatgtgtct
gttttcagaactggtgagagtctgaaaaaaggcgttgaaaagattgaatcaatttgtaga
gaatttaaaaacgtaaggatctctgattcaagtttaatatggaatactgatttgttggaa
acgttggaacttgaaaatctcttaatgttatcatatcaaactgttgtatcagctttggcc
agagaagaatccaggggcgctcactctagagatgatttccctgagcgggacgatcagatg
tggagaaagcatactttatcatgggcgaaacataggaatgtggaatctactaaaattgaa
ctggattatcgccctgtagtggataaaacacttgatagtgaaatggatactataccacct
actaaacgaaaatattag

DBGET integrated database retrieval system