KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_00130Help
Entry
BMULJ_00130       CDS       T00740                                 

Gene name
adh
Definition
(GenBank) NADP-dependent alcohol dehydrogenase
  KO
K13979  uncharacterized zinc-type alcohol dehydrogenase-like protein [EC:1.-.-.-]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Brite
KEGG Orthology (KO) [BR:bmj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BMULJ_00130 (adh)
Enzymes [BR:bmj01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     BMULJ_00130 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N 2-Hacid_dh_C AlaDh_PNT_C ADH_zinc_N_2 NAD_binding_2 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: BAG42108
UniProt: A0A0H3KBB4
LinkDB All DBs
Position
1:complement(137311..138363)
Genome map
AA seq 350 aa AA seqDB search
MSTTYAYAATDAQSPLAPFEFQRRALRDLDVQIEILYCGVCHSDLHQARNEWRNTIYPVV
PGHEIVGRVTATGPQVSRFKVGELVGVGCLVDSCRTCASCAEGLEQYCENGFVGTYNGQD
RVTGDITYGGYSTQIVVDEAFVLRVPDTLDAAGAAPLLCAGITTYSPLRQWNVGPGKKVG
IVGLGGLGHMGVKLARAMGAHVVLFTTSPSKIEDGKRLGAHEVVVSKDEAQMNAHLNSFD
FILNTVAAQHDLNPFLHLLKRDGTMTLVGAPEHDHPSPQVFNLIFKRRRLAGSLIGGIAE
TQEMLDFCAQHGITSDIEIIPMQQINAAYERMLKSDVKYRFVIDMASIKQ
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccacctatgcctacgcggcgaccgacgcgcaatcgccgctcgccccgttcgaa
tttcagcgccgcgcgctgcgcgacctcgacgtgcagatcgagatcctctactgcggcgtc
tgccattccgacctccatcaggcgcgcaacgaatggcgcaacacgatctatccggtcgtg
ccgggccacgagatcgtcgggcgggtaaccgcaaccgggccgcaggtctcgcgcttcaag
gtcggcgagctggtcggcgtcggctgtctcgtcgattcgtgccgcacctgcgcgagctgc
gcggaaggcctcgagcagtattgcgagaacggcttcgtcggcacctacaacggccaggat
cgcgtgacgggcgacatcacgtacggcggctattcgacgcagatcgtcgtcgacgaagcg
ttcgtgctgcgcgtacccgacacgctcgacgcggccggcgccgcgccgctgctttgcgcg
gggatcaccacgtattcgccgctgcgtcagtggaacgtcgggcccggcaagaaggtcggc
atcgtcggcctcggcgggctcggccacatgggcgtgaagctcgcgcgcgcgatgggcgcg
cacgtcgtgctgttcacgacgtcgccgtcgaagatcgaggacggcaagcggctcggcgcg
catgaagtcgtcgtgtcgaaggacgaagcgcagatgaacgcgcacctgaacagcttcgac
ttcatcctgaacacggtcgccgcgcagcacgacctgaatccgttcctgcatctgctcaag
cgcgacggcacgatgacgctcgtcggcgcgcccgagcacgatcacccgtcgccgcaggtg
ttcaacctgatcttcaagcgccgccgcctcgccggctcgctgatcggcgggatcgcggag
acgcaggaaatgctcgacttctgcgcgcagcacggcatcacgtccgatatcgaaatcatt
ccgatgcagcagatcaacgccgcgtacgagcggatgctgaagagcgacgtgaagtaccgg
ttcgtgatcgacatggcgtcgatcaagcagtaa

DBGET integrated database retrieval system