KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_00297Help
Entry
BMULJ_00297       CDS       T00740                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bmj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BMULJ_00297 (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmj02000]
    BMULJ_00297 (gst)
Enzymes [BR:bmj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BMULJ_00297 (gst)
Transporters [BR:bmj02000]
 Other Transporters
  Pores ion channels [TC:1]
   BMULJ_00297 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: BAG42272
UniProt: A0A0H3KK39
LinkDB All DBs
Position
1:complement(309015..309629)
Genome map
AA seq 204 aa AA seqDB search
MKLYYWPKTRAFRALWMLEEIGAVYELVPIDLRSHEQGSDAFVQVNPMAKLPALDDGSAP
FAESGAVLLYLADRCPDAGLGIAPNDPERGRFLQWMFFTPTCLEPAMAEKFTGASGNPVA
FGWGNITRVQRALAQTLAHSRWLVGDRFTAADLLLASTLKIAFDAHLLPHEGVLGDYVAR
AEDRDGYRRAVAVEQREAARLLHA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctactactggccgaaaacccgggcgttccgggcgttgtggatgctggaggaa
atcggcgccgtctacgagctggtgccgatcgacctgcgctcgcacgaacagggcagcgac
gcgttcgtgcaggtgaacccgatggcgaaactgcccgcgctcgacgacggcagcgcgccg
ttcgccgaatcgggcgcggtgctgctctacctcgccgaccgctgcccggacgcgggcctc
ggcatcgcgccgaacgacccggagcgcggccgcttcctccaatggatgttcttcacgccg
acctgtctcgagcctgcgatggcggaaaaattcaccggcgcgtcgggcaaccccgtcgcg
ttcggatggggcaacatcacgcgcgtgcagcgcgcgctcgcgcagacgctcgcgcatagc
cgatggctcgtcggcgaccgcttcaccgccgccgatctgctgctcgcgagcacgctgaag
atcgccttcgacgcgcatctgctgccgcacgaaggcgtgctcggcgactacgtcgcgcgc
gccgaggaccgcgacggataccgtcgcgcggtcgcggtcgagcagcgcgaagcggcgcgg
ctgctgcacgcgtaa

DBGET integrated database retrieval system