KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_02390Help
Entry
BMULJ_02390       CDS       T00740                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj00620  Pyruvate metabolism
bmj00680  Methane metabolism
bmj00710  Carbon fixation in photosynthetic organisms
bmj01100  Metabolic pathways
bmj01120  Microbial metabolism in diverse environments
bmj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMULJ_02390 (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BMULJ_02390 (ppc)
   00680 Methane metabolism
    BMULJ_02390 (ppc)
Enzymes [BR:bmj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BMULJ_02390 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAG44284
UniProt: A0A0H3KQH6
LinkDB All DBs
Position
1:2572769..2575783
Genome map
AA seq 1004 aa AA seqDB search
MKSSGSVRATRRNAALPSSDAPTSAVATAANGRAKPATKPKDPIRQTKRAATTRTASART
AATPKSGGRTREDKDRPLFEDIRFLGRLLGDVVREQEGDTVFDVVETIRQTAVKFRREDD
REAAQTLEKKLRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAPQPGTV
AHALDKLKTTGNASKRVLQRFFDDALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQE
LTARERQHNEAMLRARVTALWQTRMLRDARLTVGDEIENALSYYRATFLEELPALYGDIE
AALAEHGLAARVPAFFQMGSWIGGDRDGNPNVTAATLDEAINRQAAVILEHYLEQVHKLG
AELSVSNLLVGANDAVKALAAASPDQSPHRVDEPYRRALIGIYTRLAASARVRLGEGTVP
VRSAGRGAPPVRATPYADSDEFVADLKVLTASLAEHHGASLAAPRLAPLMRAAEVFGFHL
ASIDLRQSSDIHEAVVAELFARAGVVADYASLEEADKLRVLLAALADPRPLRSPYLEYSA
LAQSELGVFEKAREVRAQFGARAVRNYIISHTETVSDLVEVLLLQKETGLLEGTLGAPDG
HAKNALMVIPLFETIPDLRDASRIMREYFALPGVDALIHHQGDEQEVMLGYSDSNKDGGF
LTSNWELYRAELALVELFRERKITLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRL
TEQGEVIASKFANPEIGRRNLETVVAATLEASLLPQSNAPAQLPAFEGAMQTLSDTAMAA
YRALVYETPGFTDYFFASTPITEIAELNIGSRPASRKLQDPKNRRIEDLRAIPWGFSWGQ
CRLLLTGWYGFGSAVAAYLDGAADAAERGKRLALLKKMNKTWPFFANLLSNMDMVLAKTD
LAVASRYAELVPDRKLRNAVFGRIVAEWERTSHALAEITGHEERLATNPLLARSIKNRFP
YLDPLNHLQVELIKRHRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggtgcgcgcgacgcgccgcaatgctgccctgccctcctccgac
gccccgacgagcgccgtcgccaccgccgcgaacggccgtgcgaaaccggcaacgaaaccg
aaagacccgatacgtcagacaaaacgtgcggccacgacgcgcacggcgagcgcgcgcacc
gcggcaacgccgaagtcgggcgggcgcacgcgcgaagacaaggatcgtccgctgttcgaa
gacatccgtttcctcggccgcctgctcggcgacgtcgtgcgcgagcaggaaggcgacacg
gtgttcgacgtcgtcgaaacgattcgtcagaccgcggtcaagttccgccgcgaggacgac
cgcgaagccgcacagacgctcgagaagaagctgcgcaagctgacgcccgagcagacggtc
agcgtcgtgcgcgcgttcagctatttctcgcacctcgcgaacatcgccgaggatcgccac
cacaaccgccgccgccgcatccacgcgctcgcgggctcggcgccgcagccgggcacggtc
gcgcacgcgctcgacaagctgaaaacgaccggcaatgcgtcgaagcgcgtgctgcagcgc
ttcttcgacgacgcgctgatcgtgccggtactgaccgcgcacccgaccgaagtgcagcgc
aagagcattctcgacgcgcagcacgacatcgcgcggctgctcgccgaacgcgatcaggaa
ctgaccgcgcgcgagcgccagcacaacgaagcgatgctgcgcgcgcgcgtgaccgcgctg
tggcagacgcggatgctgcgcgacgcgcgcctgacggtcggcgacgaaatcgagaacgcg
ctgtcgtactaccgcgcgacgttcctcgaggaattgcccgcgctgtacggcgacatcgag
gccgcgctcgcggagcacgggctggccgcgcgcgtgccggcgttcttccagatgggcagc
tggatcggcggcgatcgcgacggcaatccgaacgtgacggccgccacgctcgacgaagcg
atcaaccgccaggccgccgtgatcctcgagcactatctcgagcaggtgcacaagctgggc
gccgagctgtcggtgtcgaacctgctggtcggcgcgaacgatgcggtgaaggcgctcgcg
gccgcgtcgcccgaccagtcgccgcaccgcgtcgacgagccgtaccgccgcgcgctgatc
ggcatctatacgcgccttgccgcaagtgcgcgcgtgcggctcggcgaaggcacggtgccg
gtgcgcagcgcagggcgcggcgcgccgcccgtgcgcgcgacgccgtatgcggattccgac
gagttcgtcgcggacctgaaggtgttgaccgcatcgctcgccgaacatcacggcgcgtcg
ctcgccgcgccgcgcctcgcgccgctcatgcgcgcggccgaagtgttcggcttccacctc
gcgagcatcgacctgcgccagagctccgacattcacgaagcggtggtcgccgagctgttc
gcgcgcgcgggtgtcgtggccgactacgcgtcgctcgaagaggcggacaagctgcgcgtg
ctgctcgccgcgctggccgatccgcggccgctgcgctcgccgtacctcgaatactcggcg
ctcgcgcaaagcgagctcggcgtgttcgaaaaggcgcgcgaagtgcgggcgcagttcggc
gcgcgcgcggtgcgcaactacatcatttcgcacacggaaacggtcagcgatctcgtcgag
gtgctgctgctgcagaaggagaccggcctgctcgaaggcacgctcggcgcgccggacggc
cacgcgaagaacgcgctgatggtgatcccgctgttcgagacgattcccgacctgcgcgac
gcgtcgcggatcatgcgcgagtacttcgcgctgccgggcgtcgatgcgctgatccaccat
cagggcgacgagcaggaagtcatgctcggctactcggacagcaacaaggacggcggcttc
ctgacgtccaactgggagctgtatcgcgccgagctcgcgctcgtcgaactgttccgcgag
cgcaagatcacgctgcggctgttccacggccgcggcggcacggtcggccgcggcggcggc
ccgacctatcaggcgatcctgtcgcagccgccgggcaccgtgaacggccagatccgcctg
accgaacagggcgaagtgatcgcgagcaagttcgcgaaccccgagatcggccggcgcaac
ctcgagacggtcgtcgccgcgacgctcgaggcgtcgctgctgccgcagtcgaacgcgccc
gcccagctgccggccttcgagggcgcgatgcagacgctgtccgacaccgcgatggccgcg
taccgcgcgctcgtctacgaaacgccgggcttcaccgattacttcttcgcgtcgacgccg
atcaccgaaatcgccgagctcaacatcggcagccgcccggcgtcgcgcaagctgcaggat
ccgaagaaccgcaggatcgaggatctgcgcgcgattccgtggggcttctcgtggggccag
tgccggctgctgctgaccggctggtacggcttcggcagcgcggtcgccgcgtatctggac
ggcgcggccgacgcagcggaacgcggcaagcggctcgcgttgctgaagaagatgaacaag
acctggccgttcttcgcgaacctgctgtcgaacatggacatggtgctcgcgaagaccgat
ctcgcggtcgcgtcgcgctacgccgaactcgtgccggaccgcaagctgcgcaacgcggtg
ttcgggcgcatcgtcgccgagtgggagcgcacgtcgcacgcgctcgcggagatcaccggg
cacgaggaacggctcgcgacgaatccgctgctcgcgcgctcgatcaagaaccgcttcccg
tatctcgatccgctgaatcacctgcaggtcgaactgatcaagcgccaccgcgccggcgac
acgaacgcgcggctgcgccgcgggattcatctgaccatcaacggcatcgcggccgggctg
cgcaatacgggctga

DBGET integrated database retrieval system