KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_03216Help
Entry
BMULJ_03216       CDS       T00740                                 

Gene name
kduD
Definition
(GenBank) 2-deoxy-D-gluconate 3-dehydrogenase
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase KR Glyco_trans_4_4 Glyco_transf_4 RmlD_sub_bind GDP_Man_Dehyd
Motif
Other DBs
NCBI-ProteinID: BAG45090
UniProt: A0A0H3KSJ9
LinkDB All DBs
Position
2:complement(19246..19968)
Genome map
AA seq 240 aa AA seqDB search
MSQAQTFERKTVVVTGGTSGIGAHTALRFAKAGASVVSIGLQAAGPHAPVHERIRHVELD
VADSDALTRMIGALPRIDVLVNGVGISRHADEYRMDEFEHVLNVNLTSVMRASDAARPAL
SVDGGAIVNIASMYTYFGSKDRPAYSASKGGIAQLTRSLAQAWADRGIRVNAVAPGWIDT
PLSSALMADAQASRRILERTPLGRWGKPDEVADVILFLCSPGASFVTGAIVPVDGGYSTV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagcgcagacgtttgagcgcaagaccgtcgtcgtgacgggcggtacatcggga
atcggcgcacataccgcactgcgtttcgcaaaagcgggcgcgtcggtcgtcagcatcggg
ctgcaggccgcgggcccgcatgcgccggtgcacgagcgcatccggcacgtcgagctcgac
gtggccgacagcgacgcgctgacgcgcatgatcggcgccctgccgcgcatcgacgtgctc
gtcaacggcgtcggcatcagccggcacgcggacgaatatcggatggacgaattcgagcac
gtgctgaacgtgaatctcacgtcggtgatgcgggcgtcggacgccgcgcgcccggcgctg
tccgtggatggcggcgcgatcgtcaacatcgcgtcgatgtacacgtatttcggcagcaag
gaccgacccgcgtatagcgcgagcaaaggcgggatcgcgcagctcacacgttcgctcgcg
caggcctgggccgaccgcggcattcgcgtcaatgcggtcgcgccgggctggatcgatacg
ccgctcagcagcgcgttgatggccgatgcgcaggcgtcgcgtcgaatcctcgagcgcacg
ccgctcggacgatggggcaagcccgacgaagtcgccgacgtgatcctgtttctctgctcg
cccggcgcgtcgttcgtgaccggtgcgatcgttcccgtcgacggcggctattcgacggtc
tga

DBGET integrated database retrieval system